Identification |
---|
Name: | 30S ribosomal protein S15 |
---|
Synonyms: | Not Available |
---|
Gene Name: | rpsO |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | translation |
---|
Specific Function: | One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA.In the E.coli 70S ribosome it has been modeled (PubMed:12809609) to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures (PubMed:16272117) there are minor differences between side-chain conformations. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cytosolic small ribosomal subunit | mRNA polyadenylation | rRNA binding | structural constituent of ribosome | translation |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >270
atgtctctaagtactgaagcaacagctaaaatcgtttctgagtttggtcgtgacgcaaac
gacaccggttctaccgaagttcaggtagcactgctgactgcacagatcaaccacctgcag
ggccactttgcagagcacaaaaaagatcaccacagccgtcgtggtctgctgcgcatggtt
tctcagcgtcgtaaactgctcgactacctgaaacgtaaagacgtagcacgttacacccag
ctcatcgagcgcctgggtctgcgtcgctaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 89 |
---|
Protein Molecular Weight: | 10268 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1EG0 |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >30S ribosomal protein S15
MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMV
SQRRKLLDYLKRKDVARYTQLIERLGLRR |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|