Multiple antibiotic resistance protein marA (P0ACH5)

Identification
Name:Multiple antibiotic resistance protein marA
Synonyms:Not Available
Gene Name:marA
Enzyme Class:Not Available
Biological Properties
General Function:Not Available
Specific Function:May be a transcriptional activator of genes involved in the multiple antibiotic resistance (Mar) phenotype. It can also activate genes such as sodA, zwf and micF. May be a transcriptional activator of genes involved in the multiple antibiotic resistance (Mar) phenotype. It can also activate genes such as sodA, zwf and micF.
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
  • Cationic antimicrobial peptide (CAMP) resistance eco01503
Metabolites:
ECMDB IDNameView
ECMDB21437Salicylic acidMetaboCard
GO Classification:Not Available
Gene Properties
Blattner:b1531
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>ENA|AAC74604|AAC74604.2 Escherichia coli str. K-12 substr. MG1655 DNA-binding transcriptional dual activator of multiple antibiotic resistance
ATGTCCAGACGCAATACTGACGCTATTACCATTCATAGCATTTTGGACTGGATCGAGGAC
AACCTGGAATCGCCACTGTCACTGGAGAAAGTGTCAGAGCGTTCGGGTTACTCCAAATGG
CACCTGCAACGGATGTTTAAAAAAGAAACCGGTCATTCATTAGGCCAATACATCCGCAGC
CGTAAGATGACGGAAATCGCGCAAAAGCTGAAGGAAAGTAACGAGCCGATACTCTATCTG
GCAGAACGATATGGCTTCGAGTCGCAACAAACTCTGACCCGAACCTTCAAAAATTACTTT
GATGTTCCGCCGCATAAATACCGGATGACCAATATGCAGGGCGAATCGCGCTTTTTACAT
CCATTAAATCATTACAACAGCTAG
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:Not Available
Protein Molecular Weight:Not Available
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>sp|P0ACH5|MARA_ECOLI Multiple antibiotic resistance protein marA OS=Escherichia coli (strain K12) GN=marA PE=1 SV=2
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRS
RKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLH
PLNHYNS
References
External Links:
ResourceLink
Uniprot ID:P0ACH5
ColiBase:b1531
Kegg Gene:b1531
BacMap:90111290
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Cohen, S. P., Hachler, H., Levy, S. B. (1993). "Genetic and functional analysis of the multiple antibiotic resistance (mar) locus in Escherichia coli." J Bacteriol 175:1484-1492. Pubmed: 8383113
  • Gambino, L., Gracheck, S. J., Miller, P. F. (1993). "Overexpression of the MarA positive regulator is sufficient to confer multiple antibiotic resistance in Escherichia coli." J Bacteriol 175:2888-2894. Pubmed: 8491710
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Rhee, S., Martin, R. G., Rosner, J. L., Davies, D. R. (1998). "A novel DNA-binding motif in MarA: the first structure for an AraC family transcriptional activator." Proc Natl Acad Sci U S A 95:10413-10418. Pubmed: 9724717