Protein GnsA (P0AC92)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | Protein GnsA | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | gnsA | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | identical protein binding | ||||||||
| Specific Function: | Overexpression increases levels of unsaturated fatty acids and suppresses both the temperature-sensitive fabA6 mutation and cold-sensitive secG null mutation. | ||||||||
| Cellular Location: | Not Available | ||||||||
| SMPDB Pathways: | Not Available | ||||||||
| KEGG Pathways: | Not Available | ||||||||
| Metabolites: |
| ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Blattner: | Not Available | ||||||||
| Gene Orientation | Not Available | ||||||||
| Centisome Percentage: | Not Available | ||||||||
| Left Sequence End | Not Available | ||||||||
| Right Sequence End | Not Available | ||||||||
| Gene Sequence: | >174 gtgaatattgaagagttaaaaaaacaagccgaaacggaaatcgccgactttatcgcgcaa aaaatcgccgagctgaacaagaatacagggaaagaagtctctgaaattcgcttcaccgca cgagaaaaaatgaccgggcttgaaagttatgatgtcaaaatcaaaataatgtga | ||||||||
| Protein Properties | |||||||||
| Pfam Domain Function: | Not Available | ||||||||
| Protein Residues: | 57 | ||||||||
| Protein Molecular Weight: | 6575 | ||||||||
| Protein Theoretical pI: | Not Available | ||||||||
| Signaling Regions: | Not Available | ||||||||
| Transmembrane Regions: | Not Available | ||||||||
| Protein Sequence: | >Protein GnsA MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTGLESYDVKIKIM | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | Not Available | ||||||||