| Identification |
|---|
| Name: | Flagellar biosynthetic protein FliQ |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | fliQ |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | protein secretion |
|---|
| Specific Function: | Required for the assembly of the rivet at the earliest stage of flagellar biosynthesis. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| bacterial-type flagellum assembly | | bacterial-type flagellum basal body | | integral component of membrane | | plasma membrane | | protein secretion |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >270
atgacacctgaatcggtcatgatgatggggactgaagcgatgaaagtcgcgctggcactg
gctgccccgctattgttggtagcgttggtcacgggccttatcatcagtattttgcaggcc
gccacgcagattaacgaaatgacgctgtcgtttattccgaaaatcatcgccgtatttatc
gccattattattgccggaccgtggatgctcaatctgttgctggattacgtccgcaccttg
ttcactaacctgccgtatatcatcgggtag |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 89 |
|---|
| Protein Molecular Weight: | 9631 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Flagellar biosynthetic protein FliQ
MTPESVMMMGTEAMKVALALAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFI
AIIIAGPWMLNLLLDYVRTLFTNLPYIIG |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|