Identification |
---|
Name: | Flagellar biosynthetic protein FliQ |
---|
Synonyms: | Not Available |
---|
Gene Name: | fliQ |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | protein secretion |
---|
Specific Function: | Required for the assembly of the rivet at the earliest stage of flagellar biosynthesis. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
bacterial-type flagellum assembly | bacterial-type flagellum basal body | integral component of membrane | plasma membrane | protein secretion |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >270
atgacacctgaatcggtcatgatgatggggactgaagcgatgaaagtcgcgctggcactg
gctgccccgctattgttggtagcgttggtcacgggccttatcatcagtattttgcaggcc
gccacgcagattaacgaaatgacgctgtcgtttattccgaaaatcatcgccgtatttatc
gccattattattgccggaccgtggatgctcaatctgttgctggattacgtccgcaccttg
ttcactaacctgccgtatatcatcgggtag |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 89 |
---|
Protein Molecular Weight: | 9631 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Flagellar biosynthetic protein FliQ
MTPESVMMMGTEAMKVALALAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFI
AIIIAGPWMLNLLLDYVRTLFTNLPYIIG |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|