| Identification |
|---|
| Name: | Flagellar protein FliT |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | fliT |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Dual-function protein that regulates the transcription of class 2 flagellar operons and that also acts as an export chaperone for the filament-capping protein FliD. As a transcriptional regulator, acts as an anti-FlhDC factor; it directly binds FlhC, thus inhibiting the binding of the FlhC/FlhD complex to class 2 promoters, resulting in decreased expression of class 2 flagellar operons. As a chaperone, effects FliD transition to the membrane by preventing its premature polymerization, and by directing it to the export apparatus. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| bacterial-type flagellum organization | | cytosol | | negative regulation of bacterial-type flagellum assembly | | protein folding | | regulation of transcription, DNA-templated | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >366
atgaaccatgcaccgcatttatatttcgcctggcaacaactcgtcgaaaaaagccagctc
atgttacgcctggcaacggaagaacaatgggacgaactcatcgccagcgaaatggcgtat
gtgaatgcggtgcaggagattgcacatttgactgaagaggttgacccgtccaccacgatg
caggagcagctccgcccgatgctgcgcctgattctcgacaacgaaagcaaggtaaagcag
ttattacagattcggatggatgaactggcgaaactggtcggtcagtcatcggtgcaaaaa
tcggtgttaagtgcctatggcgatcagggcggctttgtgctggctccgcaggataacctc
ttttga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 121 |
|---|
| Protein Molecular Weight: | 13828 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Flagellar protein FliT
MNHAPHLYFAWQQLVEKSQLMLRLATEEQWDELIASEMAYVNAVQEIAHLTEEVDPSTTM
QEQLRPMLRLILDNESKVKQLLQIRMDELAKLVGQSSVQKSVLSAYGDQGGFVLAPQDNL
F |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
