| Identification |
|---|
| Name: | Nitrogen regulatory protein P-II 1 |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | glnB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | P-II indirectly controls the transcription of the glutamine synthetase gene (glnA). P-II prevents NR-II-catalyzed conversion of NR-I to NR-I-phosphate, the transcriptional activator of GlnA. When P-II is uridylylated to P-II-UMP, these events are reversed. When the ratio of Gln to 2-ketoglutarate decreases, P-II is uridylylated to P-II-UMP, which causes the deadenylation of glutamine synthetase by GlnE, so activating the enzyme. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| enzyme regulator activity | | identical protein binding | | nucleotide binding | | regulation of nitrogen utilization | | regulation of transcription, DNA-templated | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >339
atgaaaaagattgatgcgattataaaacccttcaagctggacgatgtccgcgaagcactg
gccgaagtcggtattaccggcatgacggtgaccgaagtgaaaggctttggtcgccagaaa
ggccataccgagctgtaccgcggcgcggagtatatggtggattttctgccgaaagtgaaa
attgagattgtcgtaccggacgacattgtcgatacctgtgtcgataccattattcgcacg
gcgcaaaccggcaaaatcggtgacggtaaaatcttcgtctttgacgtggcacgggtcatt
cgcatccgtaccggtgaagaggacgacgcggcaatttaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 112 |
|---|
| Protein Molecular Weight: | 12425 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1PIL |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Nitrogen regulatory protein P-II 1
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVK
IEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
