Phosphocarrier protein NPr (P0A9N0)

Identification
Name:Phosphocarrier protein NPr
Synonyms:
  • Nitrogen-related HPr
Gene Name:ptsO
Enzyme Class:Not Available
Biological Properties
General Function:Carbohydrate transport and metabolism
Specific Function:Component of the phosphoenolpyruvate-dependent nitrogen- metabolic phosphotransferase system (nitrogen-metabolic PTS), that seems to be involved in regulating nitrogen metabolism. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein NPr by enzyme I-Ntr. Phospho-NPr then transfers it to EIIA-Ntr. Could function in the transcriptional regulation of sigma-54 dependent operons in conjunction with the NPr (ptsO) and EIIA-Ntr (ptsN) proteins
Cellular Location:Cytoplasm (Probable)
SMPDB Pathways:Not Available
KEGG Pathways:
  • Phosphotransferase system (PTS) ec02060
Metabolites:
ECMDB IDNameView
GO Classification:
Function
cation transmembrane transporter activity
cation:sugar symporter activity
ion transmembrane transporter activity
solute:cation symporter activity
substrate-specific transmembrane transporter activity
sugar:hydrogen symporter activity
transmembrane transporter activity
transporter activity
Process
carbohydrate transport
establishment of localization
phosphoenolpyruvate-dependent sugar phosphotransferase system
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>273 bp
GTGAATAAATCTCAATTGATCGACAAGATTGCTGCAGGGGCTGATATCTCTAAAGCTGCG
GCTGGCCGTGCGTTAGATGCTATTATTGCTTCCGTAACTGAATCTCTGAAAGAAGGGGAT
GATGTAGCACTGGTAGGTTTTGGTACTTTTGCCGTTAAAGAGCGTGCTGCCCGTACTGGC
CGCAACCCGCAGACCGGTAAAGAGATCACCATCGCTGCTGCTAAAGTACCGAGCTTCCGT
GCAGGTAAAGCACTGAAAGACGCGGTAAACTAA
Protein Properties
Pfam Domain Function:
Protein Residues:90
Protein Molecular Weight:9810
Protein Theoretical pI:4
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Phosphocarrier protein NPr
MTVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKG
RQIEVEATGPQEEEALAAVIALFNSGFDED
References
External Links:
ResourceLink
Uniprot ID:P0A9N0
Uniprot Name:PTSO_ECOLI
GenBank Gene ID:U00096
Genebank Protein ID:1786644
CCDB:PTSO_ECOLI
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Jones, D. H., Franklin, F. C., Thomas, C. M. (1994). "Molecular analysis of the operon which encodes the RNA polymerase sigma factor sigma 54 of Escherichia coli." Microbiology 140 ( Pt 5):1035-1043. Pubmed: 8025669
  • Powell, B. S., Court, D. L., Inada, T., Nakamura, Y., Michotey, V., Cui, X., Reizer, A., Saier, M. H. Jr, Reizer, J. (1995). "Novel proteins of the phosphotransferase system encoded within the rpoN operon of Escherichia coli. Enzyme IIANtr affects growth on organic nitrogen and the conditional lethality of an erats mutant." J Biol Chem 270:4822-4839. Pubmed: 7876255