
Protein NapD (P0A9I5)
| Identification | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Name: | Protein NapD | ||||||||||
| Synonyms: | Not Available | ||||||||||
| Gene Name: | napD | ||||||||||
| Enzyme Class: | Not Available | ||||||||||
| Biological Properties | |||||||||||
| General Function: | negative regulation of protein transport | ||||||||||
| Specific Function: | Plays a role in the correct assembly of subunits of the periplasmic NapAB enzyme. | ||||||||||
| Cellular Location: | Not Available | ||||||||||
| SMPDB Pathways: | Not Available | ||||||||||
| KEGG Pathways: | Not Available | ||||||||||
| Metabolites: |
| ||||||||||
| GO Classification: |
| ||||||||||
| Gene Properties | |||||||||||
| Blattner: | Not Available | ||||||||||
| Gene Orientation | Not Available | ||||||||||
| Centisome Percentage: | Not Available | ||||||||||
| Left Sequence End | Not Available | ||||||||||
| Right Sequence End | Not Available | ||||||||||
| Gene Sequence: | >264 atgcacactaactggcaagtttgcagcctggtcgtgcaggccaaaagcgaacgaatttca gacatcagcacccaactgaacgcctttcccggctgtgaagttgctgtcagcgacgcgccg agcggtcagttgattgtggtggtggaagcagaagacagcgaaacgctgatccaaaccatt gagtcagtacgcaacgtagagggcgtgctggcggtgtcgctggtttatcaccagcaggaa gagcaaggtgaggaaacaccatga | ||||||||||
| Protein Properties | |||||||||||
| Pfam Domain Function: | Not Available | ||||||||||
| Protein Residues: | 87 | ||||||||||
| Protein Molecular Weight: | 9468 | ||||||||||
| Protein Theoretical pI: | Not Available | ||||||||||
| PDB File: | 2JSX | ||||||||||
| Signaling Regions: | Not Available | ||||||||||
| Transmembrane Regions: | Not Available | ||||||||||
| Protein Sequence: | >Protein NapD MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTI ESVRNVEGVLAVSLVYHQQEEQGEETP | ||||||||||
| References | |||||||||||
| External Links: |
| ||||||||||
| General Reference: | Not Available | ||||||||||