Protein NapD (P0A9I5)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Name: | Protein NapD | ||||||||||
Synonyms: | Not Available | ||||||||||
Gene Name: | napD | ||||||||||
Enzyme Class: | Not Available | ||||||||||
Biological Properties | |||||||||||
General Function: | negative regulation of protein transport | ||||||||||
Specific Function: | Plays a role in the correct assembly of subunits of the periplasmic NapAB enzyme. | ||||||||||
Cellular Location: | Not Available | ||||||||||
SMPDB Pathways: | Not Available | ||||||||||
KEGG Pathways: | Not Available | ||||||||||
Metabolites: |
| ||||||||||
GO Classification: |
| ||||||||||
Gene Properties | |||||||||||
Blattner: | Not Available | ||||||||||
Gene Orientation | Not Available | ||||||||||
Centisome Percentage: | Not Available | ||||||||||
Left Sequence End | Not Available | ||||||||||
Right Sequence End | Not Available | ||||||||||
Gene Sequence: | >264 atgcacactaactggcaagtttgcagcctggtcgtgcaggccaaaagcgaacgaatttca gacatcagcacccaactgaacgcctttcccggctgtgaagttgctgtcagcgacgcgccg agcggtcagttgattgtggtggtggaagcagaagacagcgaaacgctgatccaaaccatt gagtcagtacgcaacgtagagggcgtgctggcggtgtcgctggtttatcaccagcaggaa gagcaaggtgaggaaacaccatga | ||||||||||
Protein Properties | |||||||||||
Pfam Domain Function: | Not Available | ||||||||||
Protein Residues: | 87 | ||||||||||
Protein Molecular Weight: | 9468 | ||||||||||
Protein Theoretical pI: | Not Available | ||||||||||
PDB File: | 2JSX | ||||||||||
Signaling Regions: | Not Available | ||||||||||
Transmembrane Regions: | Not Available | ||||||||||
Protein Sequence: | >Protein NapD MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTI ESVRNVEGVLAVSLVYHQQEEQGEETP | ||||||||||
References | |||||||||||
External Links: |
| ||||||||||
General Reference: | Not Available |