| Identification |
|---|
| Name: | Flagellar transcriptional regulator FlhD |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | flhD |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Functions in complex with FlhC as a master transcriptional regulator that regulates transcription of several flagellar and non-flagellar operons by binding to their promoter region. Activates expression of class 2 flagellar genes, including fliA, which is a flagellum-specific sigma factor that turns on the class 3 genes. Also regulates genes whose products function in a variety of physiological pathways. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| bacterial-type flagellum assembly | | cytoplasm | | DNA binding | | positive regulation of transcription, DNA-templated | | regulation of bacterial-type flagellum assembly | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >351
atgcatacctccgagttgctgaaacacatttatgacatcaacttgtcatatttactactt
gcacagcgtttgattgttcaggacaaagcgtccgctatgtttcgtctcggcataaatgaa
gaaatggcgacaacgttagcggcactgactcttccgcaaatggttaagctggcagaaacc
aatcaactggtttgtcacttccgttttgacagccaccagacgattactcagttgacgcaa
gattcccgcgttgacgatctccagcaaattcataccggcatcatgctctcaacacgcttg
ctgaatgatgttaatcagcctgaagaagcgctgcgcaagaaaagggcctga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 116 |
|---|
| Protein Molecular Weight: | 13316 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1G8E |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Flagellar transcriptional regulator FlhD
MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLAALTLPQMVKLAET
NQLVCHFRFDSHQTITQLTQDSRVDDLQQIHTGIMLSTRLLNDVNQPEEALRKKRA |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
