| Identification |
|---|
| Name: | Exodeoxyribonuclease 7 small subunit |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | xseB |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | DNA catabolic process |
|---|
| Specific Function: | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. It can also degrade 3' or 5' ss regions extending from the termini of duplex DNA molecules and displaced ss regions. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytoplasm | | DNA catabolic process | | exodeoxyribonuclease VII activity | | exodeoxyribonuclease VII complex |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >243
atgccgaagaaaaatgaggcgcccgccagctttgaaaaggcgctgagcgagctggaacag
attgtaacccgtctggaaagtggcgacctgccgctggaagaggcgctgaacgagttcgaa
cgcggcgtgcagctggcacgtcaggggcaggccaaattacaacaagccgaacagcgcgta
caaattctgctgtctgacaatgaagacgcctctctaaccccttttacaccggacaatgag
taa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 80 |
|---|
| Protein Molecular Weight: | 8951 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Exodeoxyribonuclease 7 small subunit
MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAEQRV
QILLSDNEDASLTPFTPDNE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
