Identification |
---|
Name: | Putative membrane protein insertion efficiency factor |
---|
Synonyms: | Not Available |
---|
Gene Name: | yidD |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | protein transport |
---|
Specific Function: | Could be involved in insertion of integral membrane proteins into the membrane. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
integral component of plasma membrane | membrane insertase activity | protein insertion into membrane | protein transport |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >258
atggcgccgccactgtcgcctggctcgcgggtcctgatagccctcattcgggtctatcaa
cgcctgattagtccgctactcgggccgcattgtcgtttcactccaacctgttcaagctac
ggaattgaggcattgcgcaggtttggagtgataaaaggcagttggttgacggtgaaacgc
gtattaaaatgccaccctttacaccctggtggtgacgatcccgtcccgcccggaccattt
gataccagagaacactaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 85 |
---|
Protein Molecular Weight: | 9380 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Putative membrane protein insertion efficiency factor
MAPPLSPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKR
VLKCHPLHPGGDDPVPPGPFDTREH |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|