| Identification |
|---|
| Name: | Putative membrane protein insertion efficiency factor |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | yidD |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | protein transport |
|---|
| Specific Function: | Could be involved in insertion of integral membrane proteins into the membrane. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| integral component of plasma membrane | | membrane insertase activity | | protein insertion into membrane | | protein transport |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >258
atggcgccgccactgtcgcctggctcgcgggtcctgatagccctcattcgggtctatcaa
cgcctgattagtccgctactcgggccgcattgtcgtttcactccaacctgttcaagctac
ggaattgaggcattgcgcaggtttggagtgataaaaggcagttggttgacggtgaaacgc
gtattaaaatgccaccctttacaccctggtggtgacgatcccgtcccgcccggaccattt
gataccagagaacactaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 85 |
|---|
| Protein Molecular Weight: | 9380 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Putative membrane protein insertion efficiency factor
MAPPLSPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKR
VLKCHPLHPGGDDPVPPGPFDTREH |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|