Identification |
---|
Name: | DNA-directed RNA polymerase subunit omega |
---|
Synonyms: | - RNAP omega subunit
- RNA polymerase omega subunit
- Transcriptase subunit omega
|
---|
Gene Name: | rpoZ |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in DNA-directed RNA polymerase activity |
---|
Specific Function: | Promotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits |
---|
Cellular Location: | Cytoplasmic |
---|
SMPDB Pathways: | |
---|
KEGG Pathways: | |
---|
KEGG Reactions: | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0RNA | + | 1.0RNA | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB04142/thumb.png) | + | 1.0RNA |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01273/thumb.png) | + | 1.0RNA | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB04142/thumb.png) | + | 1.0RNA |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00082/thumb.png) | + | 1.0RNA | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB04142/thumb.png) | + | 1.0RNA |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00285/thumb.png) | + | 1.0RNA | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB04142/thumb.png) | + | 1.0RNA |
| | |
1.0Nucleoside triphosphate | + | 1.0RNA | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB04142/thumb.png) |
| |
|
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
binding | catalytic activity | DNA binding | DNA-directed RNA polymerase activity | nucleic acid binding | nucleotidyltransferase activity | RNA polymerase activity | transferase activity | transferase activity, transferring phosphorus-containing groups | Process |
---|
biosynthetic process | cellular macromolecule biosynthetic process | macromolecule biosynthetic process | metabolic process | transcription | transcription, DNA-dependent |
|
---|
Gene Properties |
---|
Blattner: | b3649 |
---|
Gene Orientation | Clockwise |
---|
Centisome Percentage: | 82.34 |
---|
Left Sequence End | 3820129 |
---|
Right Sequence End | 3820404 |
---|
Gene Sequence: | >276 bp
ATGAAAATAATCTCTAAAATGTTAGTCGGTGCGTTAGCGTTAGCCGTTACCAATGTCTAT
GCCGCTGAATTGATGACCAAAGCGGAATTTGAAAAAGTTGAATCGCAGTATGAAAAAATA
GGTGATATTTCAACCAGCAATGAAATGTCGACTGCAGATGCAAAAGAAGATTTGATCAAA
AAAGCGGATGAAAAAGGGGCTGATGTGTTGGTACTGACCTCCGGTCAAACTGACAATAAG
ATCCACGGCACGGCAAATATTTATAAGAAGAAGTAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 91 |
---|
Protein Molecular Weight: | 10237 |
---|
Protein Theoretical pI: | 5 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >DNA-directed RNA polymerase subunit omega
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
- Gentry, D. R., Burgess, R. R. (1986). "The cloning and sequence of the gene encoding the omega subunit of Escherichia coli RNA polymerase." Gene 48:33-40. Pubmed: 3549461
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Sarubbi, E., Rudd, K. E., Xiao, H., Ikehara, K., Kalman, M., Cashel, M. (1989). "Characterization of the spoT gene of Escherichia coli." J Biol Chem 264:15074-15082. Pubmed: 2549050
|
---|