| Identification |
|---|
| Name: | DNA-directed RNA polymerase subunit omega |
|---|
| Synonyms: | - RNAP omega subunit
- RNA polymerase omega subunit
- Transcriptase subunit omega
|
|---|
| Gene Name: | rpoZ |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in DNA-directed RNA polymerase activity |
|---|
| Specific Function: | Promotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits |
|---|
| Cellular Location: | Cytoplasmic |
|---|
| SMPDB Pathways: | |
|---|
| KEGG Pathways: | |
|---|
| KEGG Reactions: | |
1.0 | + | 1.0RNA | + | 1.0RNA | ↔ | 1.0 | + | 1.0RNA |
| | |
1.0 | + | 1.0RNA | ↔ | 1.0 | + | 1.0RNA |
| | |
1.0 | + | 1.0RNA | ↔ | 1.0 | + | 1.0RNA |
| | |
1.0 | + | 1.0RNA | ↔ | 1.0 | + | 1.0RNA |
| | |
1.0Nucleoside triphosphate | + | 1.0RNA | ↔ | 1.0 |
| |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| binding | | catalytic activity | | DNA binding | | DNA-directed RNA polymerase activity | | nucleic acid binding | | nucleotidyltransferase activity | | RNA polymerase activity | | transferase activity | | transferase activity, transferring phosphorus-containing groups | | Process |
|---|
| biosynthetic process | | cellular macromolecule biosynthetic process | | macromolecule biosynthetic process | | metabolic process | | transcription | | transcription, DNA-dependent |
|
|---|
| Gene Properties |
|---|
| Blattner: | b3649 |
|---|
| Gene Orientation | Clockwise |
|---|
| Centisome Percentage: | 82.34 |
|---|
| Left Sequence End | 3820129 |
|---|
| Right Sequence End | 3820404 |
|---|
| Gene Sequence: | >276 bp
ATGAAAATAATCTCTAAAATGTTAGTCGGTGCGTTAGCGTTAGCCGTTACCAATGTCTAT
GCCGCTGAATTGATGACCAAAGCGGAATTTGAAAAAGTTGAATCGCAGTATGAAAAAATA
GGTGATATTTCAACCAGCAATGAAATGTCGACTGCAGATGCAAAAGAAGATTTGATCAAA
AAAGCGGATGAAAAAGGGGCTGATGTGTTGGTACTGACCTCCGGTCAAACTGACAATAAG
ATCCACGGCACGGCAAATATTTATAAGAAGAAGTAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 91 |
|---|
| Protein Molecular Weight: | 10237 |
|---|
| Protein Theoretical pI: | 5 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >DNA-directed RNA polymerase subunit omega
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
- Gentry, D. R., Burgess, R. R. (1986). "The cloning and sequence of the gene encoding the omega subunit of Escherichia coli RNA polymerase." Gene 48:33-40. Pubmed: 3549461
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Sarubbi, E., Rudd, K. E., Xiao, H., Ikehara, K., Kalman, M., Cashel, M. (1989). "Characterization of the spoT gene of Escherichia coli." J Biol Chem 264:15074-15082. Pubmed: 2549050
|
|---|