| Identification |
|---|
| Name: | Ribonuclease P protein component |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rnpA |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | tRNA processing |
|---|
| Specific Function: | RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| ribonuclease P activity | | RNA phosphodiester bond hydrolysis | | RNA phosphodiester bond hydrolysis, endonucleolytic | | RNA processing | | tRNA 5'-leader removal | | tRNA binding | | tRNA processing |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >360
gtggttaagctcgcatttcccagggagttacgcttgttaactcccagtcaattcacattc
gtcttccagcagccacaacgggctggcacgccgcaaattaccattctcggccgcctgaat
tcgctggggcatccccgtatcggtcttacagtcgccaagaaaaacgttcgacgcgcccat
gaacgcaatcggattaaacgtctgacgcgtgaaagcttccgtctgcgccaacatgaactc
ccggctatggatttcgtggtggtggcgaaaaaaggggttgccgacctcgataaccgtgct
ctctcggaagcgttggaaaaattatggcgccgccactgtcgcctggctcgcgggtcctga
|
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 119 |
|---|
| Protein Molecular Weight: | 13789 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2LJP |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Ribonuclease P protein component
MVKLAFPRELRLLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLTVAKKNVRRAH
ERNRIKRLTRESFRLRQHELPAMDFVVVAKKGVADLDNRALSEALEKLWRRHCRLARGS |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|