Identification |
---|
Name: | Ribonuclease P protein component |
---|
Synonyms: | Not Available |
---|
Gene Name: | rnpA |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | tRNA processing |
---|
Specific Function: | RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
ribonuclease P activity | RNA phosphodiester bond hydrolysis | RNA phosphodiester bond hydrolysis, endonucleolytic | RNA processing | tRNA 5'-leader removal | tRNA binding | tRNA processing |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >360
gtggttaagctcgcatttcccagggagttacgcttgttaactcccagtcaattcacattc
gtcttccagcagccacaacgggctggcacgccgcaaattaccattctcggccgcctgaat
tcgctggggcatccccgtatcggtcttacagtcgccaagaaaaacgttcgacgcgcccat
gaacgcaatcggattaaacgtctgacgcgtgaaagcttccgtctgcgccaacatgaactc
ccggctatggatttcgtggtggtggcgaaaaaaggggttgccgacctcgataaccgtgct
ctctcggaagcgttggaaaaattatggcgccgccactgtcgcctggctcgcgggtcctga
|
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 119 |
---|
Protein Molecular Weight: | 13789 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 2LJP |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Ribonuclease P protein component
MVKLAFPRELRLLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLTVAKKNVRRAH
ERNRIKRLTRESFRLRQHELPAMDFVVVAKKGVADLDNRALSEALEKLWRRHCRLARGS |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|