Ribonuclease HI (P0A7Y4)

Identification
Name:Ribonuclease HI
Synonyms:
  • RNase HI
  • Ribonuclease H
  • RNase H
Gene Name:rnhA
Enzyme Class:
Biological Properties
General Function:Involved in ribonuclease H activity
Specific Function:Endonuclease that specifically degrades the RNA of RNA- DNA hybrids. RNase H participates in DNA replication; it helps to specify the origin of genomic replication by suppressing initiation at origins other than the oriC locus; along with the 5'-3' exonuclease of pol1, it removes RNA primers from the Okazaki fragments of lagging strand synthesis; and it defines the origin of replication for ColE1-type plasmids by specific cleavage of an RNA preprimer
Cellular Location:Cytoplasm (Potential)
SMPDB Pathways:Not Available
KEGG Pathways:
EcoCyc Reactions:
1.0Thumb ? 1.0a nucleoside monophosphate
1.0Water ? 1.0a nucleoside monophosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
catalytic activity
endonuclease activity
endoribonuclease activity
endoribonuclease activity, producing 5'-phosphomonoesters
hydrolase activity
hydrolase activity, acting on ester bonds
nuclease activity
nucleic acid binding
ribonuclease H activity
Gene Properties
Blattner:b0214
Gene OrientationCounterclockwise
Centisome Percentage:5.08
Left Sequence End235535
Right Sequence End236002
Gene Sequence:
>468 bp
ATGCTTAAACAGGTAGAAATTTTCACCGATGGTTCGTGTCTGGGCAATCCAGGACCTGGG
GGTTACGGCGCTATTTTACGCTATCGCGGACGCGAGAAAACCTTTAGCGCTGGCTACACC
CGCACCACCAACAACCGTATGGAGTTGATGGCCGCTATTGTCGCGCTGGAGGCGTTAAAA
GAACATTGCGAAGTCATTTTGAGTACCGACAGCCAGTATGTCCGCCAGGGTATCACCCAG
TGGATCCATAACTGGAAAAAACGTGGCTGGAAAACCGCAGACAAAAAACCAGTAAAAAAT
GTCGATCTCTGGCAACGTCTTGATGCTGCATTGGGGCAGCATCAAATCAAATGGGAATGG
GTTAAAGGCCATGCCGGACACCCGGAAAACGAACGCTGTGATGAACTGGCTCGTGCCGCG
GCGATGAATCCCACACTGGAAGATACAGGCTACCAAGTTGAAGTTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:155
Protein Molecular Weight:17597
Protein Theoretical pI:8
PDB File:1RCH
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Ribonuclease HI
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALK
EHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEW
VKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
References
External Links:
ResourceLink
Uniprot ID:P0A7Y4
Uniprot Name:RNH_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4902951
PDB ID:1RCH
Ecogene ID:EG10860
Ecocyc:EG10860
ColiBase:b0214
Kegg Gene:b0214
EchoBASE ID:EB0853
CCDB:RNH_ECOLI
BacMap:16128201
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Cox, E. C., Horner, D. L. (1986). "DNA sequence and coding properties of mutD(dnaQ) a dominant Escherichia coli mutator gene." J Mol Biol 190:113-117. Pubmed: 3023634
  • Goedken, E. R., Keck, J. L., Berger, J. M., Marqusee, S. (2000). "Divalent metal cofactor binding in the kinetic folding trajectory of Escherichia coli ribonuclease HI." Protein Sci 9:1914-1921. Pubmed: 11106164
  • Goedken, E. R., Marqusee, S. (2001). "Co-crystal of Escherichia coli RNase HI with Mn2+ ions reveals two divalent metals bound in the active site." J Biol Chem 276:7266-7271. Pubmed: 11083878
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Ishikawa, K., Kimura, S., Kanaya, S., Morikawa, K., Nakamura, H. (1993). "Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability." Protein Eng 6:85-91. Pubmed: 8381958
  • Kanaya, S., Crouch, R. J. (1983). "DNA sequence of the gene coding for Escherichia coli ribonuclease H." J Biol Chem 258:1276-1281. Pubmed: 6296074
  • Kanaya, S., Crouch, R. J. (1983). "Low levels of RNase H activity in Escherichia coli FB2 rnh result from a single-base change in the structural gene of RNase H." J Bacteriol 154:1021-1026. Pubmed: 6302075
  • Kanaya, S., Kimura, S., Katsuda, C., Ikehara, M. (1990). "Role of cysteine residues in ribonuclease H from Escherichia coli. Site-directed mutagenesis and chemical modification." Biochem J 271:59-66. Pubmed: 2171503
  • Kanaya, S., Kohara, A., Miura, Y., Sekiguchi, A., Iwai, S., Inoue, H., Ohtsuka, E., Ikehara, M. (1990). "Identification of the amino acid residues involved in an active site of Escherichia coli ribonuclease H by site-directed mutagenesis." J Biol Chem 265:4615-4621. Pubmed: 1689729
  • Kashiwagi, T., Jeanteur, D., Haruki, M., Katayanagi, K., Kanaya, S., Morikawa, K. (1996). "Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI." Protein Eng 9:857-867. Pubmed: 8931125
  • Katayanagi, K., Ishikawa, M., Okumura, M., Ariyoshi, M., Kanaya, S., Kawano, Y., Suzuki, M., Tanaka, I., Morikawa, K. (1993). "Crystal structures of ribonuclease HI active site mutants from Escherichia coli." J Biol Chem 268:22092-22099. Pubmed: 8408067
  • Katayanagi, K., Miyagawa, M., Matsushima, M., Ishikawa, M., Kanaya, S., Ikehara, M., Matsuzaki, T., Morikawa, K. (1990). "Three-dimensional structure of ribonuclease H from E. coli." Nature 347:306-309. Pubmed: 1698262
  • Katayanagi, K., Miyagawa, M., Matsushima, M., Ishikawa, M., Kanaya, S., Nakamura, H., Ikehara, M., Matsuzaki, T., Morikawa, K. (1992). "Structural details of ribonuclease H from Escherichia coli as refined to an atomic resolution." J Mol Biol 223:1029-1052. Pubmed: 1311386
  • Keck, J. L., Goedken, E. R., Marqusee, S. (1998). "Activation/attenuation model for RNase H. A one-metal mechanism with second-metal inhibition." J Biol Chem 273:34128-34133. Pubmed: 9852071
  • Maki, H., Horiuchi, T., Sekiguchi, M. (1983). "Structure and expression of the dnaQ mutator and the RNase H genes of Escherichia coli: overlap of the promoter regions." Proc Natl Acad Sci U S A 80:7137-7141. Pubmed: 6316347
  • Tsunaka, Y., Takano, K., Matsumura, H., Yamagata, Y., Kanaya, S. (2005). "Identification of single Mn(2+) binding sites required for activation of the mutant proteins of E.coli RNase HI at Glu48 and/or Asp134 by X-ray crystallography." J Mol Biol 345:1171-1183. Pubmed: 15644213
  • Yamasaki, K., Ogasahara, K., Yutani, K., Oobatake, M., Kanaya, S. (1995). "Folding pathway of Escherichia coli ribonuclease HI: a circular dichroism, fluorescence, and NMR study." Biochemistry 34:16552-16562. Pubmed: 8527428
  • Yamazaki, T., Yoshida, M., Kanaya, S., Nakamura, H., Nagayama, K. (1991). "Assignments of backbone 1H, 13C, and 15N resonances and secondary structure of ribonuclease H from Escherichia coli by heteronuclear three-dimensional NMR spectroscopy." Biochemistry 30:6036-6047. Pubmed: 1646006
  • Yang, W., Hendrickson, W. A., Crouch, R. J., Satow, Y. (1990). "Structure of ribonuclease H phased at 2 A resolution by MAD analysis of the selenomethionyl protein." Science 249:1398-1405. Pubmed: 2169648