Identification |
---|
Name: | 30S ribosomal protein S4 |
---|
Synonyms: | Not Available |
---|
Gene Name: | rpsD |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | translation |
---|
Specific Function: | One of two assembly initiator proteins for the 30S subunit, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit.With S5 and S12 plays an important role in translational accuracy; many suppressors of streptomycin-dependent mutants of protein S12 are found in this protein, some but not all of which decrease translational accuracy (ram, ribosomal ambiguity mutations).Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp.Protein S4 is also a translational repressor protein, it controls the translation of the alpha-operon (which codes for S13, S11, S4, RNA polymerase alpha subunit, and L17) by binding to its mRNA.Also functions as a rho-dependent antiterminator of rRNA transcription, increasing the synthesis of rRNA under conditions of excess protein, allowing a more rapid return to homeostasis. Binds directly to RNA polymerase. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cytosolic small ribosomal subunit | DNA-templated transcription, termination | mRNA 5'-UTR binding | negative regulation of translational initiation | positive regulation of translational fidelity | response to antibiotic | rRNA binding | structural constituent of ribosome | transcription antitermination | translation | translation repressor activity, nucleic acid binding |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >621
atggcaagatatttgggtcctaagctcaagctgagccgtcgtgagggcaccgacttattc
cttaagtctggcgttcgcgcgatcgataccaagtgtaaaattgaacaagctcctggccag
cacggtgcgcgtaaaccgcgtctgtctgactatggtgtgcagttgcgtgaaaagcaaaaa
gttcgccgtatctatggtgtgctggagcgtcagttccgtaactactacaaagaagcagca
cgtctgaaaggcaacaccggtgaaaacctgttggctctgctggaaggtcgtctggacaac
gttgtataccgtatgggcttcggtgccactcgtgcagaagcacgtcagctggttagccat
aaagcaattatggtaaacggtcgtgttgttaacatcgcttcttatcaggttagtccgaat
gacgttgtaagcattcgtgagaaagcgaagaagcagtctcgcgtgaaagccgctctggag
ctggctgagcagcgtgaaaagccaacctggctggaagttgatgctggcaagatggaaggt
acgtttaagcgtaagccggagcgttctgatctgtctgcggacattaacgaacacctgatc
gtcgagctttactccaagtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 206 |
---|
Protein Molecular Weight: | 23468 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1EG0 |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >30S ribosomal protein S4
MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDYGVQLREKQK
VRRIYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNVVYRMGFGATRAEARQLVSH
KAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAEQREKPTWLEVDAGKMEG
TFKRKPERSDLSADINEHLIVELYSK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|