| Identification |
|---|
| Name: | 30S ribosomal protein S19 |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rpsS |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | translation |
|---|
| Specific Function: | In the E.coli 70S ribosome in the initiation state (PubMed:12809609) it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B1a; this bridge is broken in the model with bound EF-G. The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states (PubMed:12859903), contacting alternately S13 or S19. In the 3.5 angstroms resolved ribosome structures (PubMed:16272117) the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder.Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA. Contacts the A site tRNA. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosolic small ribosomal subunit | | poly(A) RNA binding | | ribosomal small subunit assembly | | rRNA binding | | structural constituent of ribosome | | translation | | tRNA binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >279
atgccacgttctctcaagaaaggtccttttattgacctgcacttgctgaagaaggtagag
aaagcggtggaaagcggagacaagaagcccctgcgcacttggtcccgtcgttcaacgatc
tttcctaacatgatcggtttgaccatcgctgtccataatggtcgtcagcacgttccggta
tttgtaaccgacgaaatggttggtcacaaactgggtgaattcgcaccgactcgtacttat
cgcggccacgctgctgataaaaaagcgaagaagaaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 92 |
|---|
| Protein Molecular Weight: | 10430 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1M5G |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >30S ribosomal protein S19
MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPV
FVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
