| Identification |
|---|
| Name: | 30S ribosomal protein S18 |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rpsR |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | translation |
|---|
| Specific Function: | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosolic small ribosomal subunit | | mRNA 5'-UTR binding | | small ribosomal subunit rRNA binding | | structural constituent of ribosome | | translation |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >228
atggcacgttatttccgtcgtcgcaagttctgccgtttcaccgcggaaggcgttcaagag
atcgactataaagatatcgctacgctgaaaaactacatcaccgaaagcggtaagattgtc
ccaagccgtatcaccggtacccgtgcaaaataccagcgtcagctggctcgcgctatcaaa
cgcgctcgctacctgtccctgctgccgtacactgatcgccatcagtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 75 |
|---|
| Protein Molecular Weight: | 8986 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1M5G |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >30S ribosomal protein S18
MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIK
RARYLSLLPYTDRHQ |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|