Identification |
---|
Name: | 30S ribosomal protein S18 |
---|
Synonyms: | Not Available |
---|
Gene Name: | rpsR |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | translation |
---|
Specific Function: | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cytosolic small ribosomal subunit | mRNA 5'-UTR binding | small ribosomal subunit rRNA binding | structural constituent of ribosome | translation |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >228
atggcacgttatttccgtcgtcgcaagttctgccgtttcaccgcggaaggcgttcaagag
atcgactataaagatatcgctacgctgaaaaactacatcaccgaaagcggtaagattgtc
ccaagccgtatcaccggtacccgtgcaaaataccagcgtcagctggctcgcgctatcaaa
cgcgctcgctacctgtccctgctgccgtacactgatcgccatcagtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 75 |
---|
Protein Molecular Weight: | 8986 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1M5G |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >30S ribosomal protein S18
MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIK
RARYLSLLPYTDRHQ |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|