Identification |
---|
Name: | 30S ribosomal protein S16 |
---|
Synonyms: | Not Available |
---|
Gene Name: | rpsP |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | translation |
---|
Specific Function: | In addition to being a ribosomal protein, S16 also has a cation-dependent endonuclease activity.In-frame fusions with the ribosome maturation factor rimM suppress mutations in the latter (probably due to increased rimM expression) and are found in translationally active 70S ribosomes. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cytosolic small ribosomal subunit | DNA metabolic process | endodeoxyribonuclease activity | ribosomal small subunit assembly | structural constituent of ribosome | structure-specific DNA binding | translation |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >249
atggtaactattcgtttagcacgtcacggcgctaaaaagcgtccgttctaccaggttgtt
gtcgctgacagccgtaatgcacgcaacggtcgcttcatcgagcgcgttggtttcttcaac
ccaatcgctagcgaaaaagaagaaggcactcgcctggatctggatcgcatcgctcactgg
gttggccagggcgcaactatttctgatcgcgttgctgcgctgatcaaagaagtaaacaaa
gcagcttaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 82 |
---|
Protein Molecular Weight: | 9190 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1M5G |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >30S ribosomal protein S16
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHW
VGQGATISDRVAALIKEVNKAA |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|