| Identification |
|---|
| Name: | 30S ribosomal protein S16 |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rpsP |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | translation |
|---|
| Specific Function: | In addition to being a ribosomal protein, S16 also has a cation-dependent endonuclease activity.In-frame fusions with the ribosome maturation factor rimM suppress mutations in the latter (probably due to increased rimM expression) and are found in translationally active 70S ribosomes. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosolic small ribosomal subunit | | DNA metabolic process | | endodeoxyribonuclease activity | | ribosomal small subunit assembly | | structural constituent of ribosome | | structure-specific DNA binding | | translation |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >249
atggtaactattcgtttagcacgtcacggcgctaaaaagcgtccgttctaccaggttgtt
gtcgctgacagccgtaatgcacgcaacggtcgcttcatcgagcgcgttggtttcttcaac
ccaatcgctagcgaaaaagaagaaggcactcgcctggatctggatcgcatcgctcactgg
gttggccagggcgcaactatttctgatcgcgttgctgcgctgatcaaagaagtaaacaaa
gcagcttaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 82 |
|---|
| Protein Molecular Weight: | 9190 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1M5G |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >30S ribosomal protein S16
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHW
VGQGATISDRVAALIKEVNKAA |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|