| Identification |
|---|
| Name: | 30S ribosomal protein S13 |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rpsM |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | translation |
|---|
| Specific Function: | Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.In the E.coli 70S ribosome in the initiation state (PubMed:12809609) was modeled to contact the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; bridge B1a is broken in the model with bound EF-G, while the protein-protein contacts between S13 and L5 in B1b change (PubMed:12809609). The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states (PubMed:16272117), contacting alternately S13 or S19. In the two 3.5 angstroms resolved ribosome structures (PubMed:12859903) the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder.Contacts the tRNAs in the A and P sites.The C-terminal tail plays a role in the affinity of the 30S P site for different tRNAs. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosolic small ribosomal subunit | | rRNA binding | | structural constituent of ribosome | | translation | | tRNA binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >357
gtggcccgtatagcaggcattaacattcctgatcataagcatgccgtaatcgcattaact
tcgatttatggcgtcggcaagacccgttctaaagccatcctggctgcagcgggtatcgct
gaagatgttaagatcagtgagctgtctgaaggacaaatcgacacgctgcgtgacgaagtt
gccaaatttgtcgttgaaggtgatctgcgccgtgaaatcagcatgagcatcaagcgcctg
atggatcttggttgctatcgcggtttgcgtcatcgtcgtggtctcccggttcgcggtcag
cgtaccaagaccaacgcacgtacccgtaagggtccgcgcaaaccgatcaagaaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 118 |
|---|
| Protein Molecular Weight: | 13099 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1M5G |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >30S ribosomal protein S13
MARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEV
AKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
