| Identification |
|---|
| Name: | 50S ribosomal protein L7/L12 |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rplL |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | translation |
|---|
| Specific Function: | The binding site for several of the GTPase factors involved in protein synthesis (IF-2, EF-Tu, EF-G and RF3). Is thus essential for accurate translation. Deletion of 1 of the L12 dimers from the ribosome (by deleting the binding site on L10) leads to decreased IF-2 association with the 70S ribosome and decreased stimulation of the GTPase activity of EF-G. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosolic large ribosomal subunit | | structural constituent of ribosome | | translation |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >366
atgtctatcactaaagatcaaatcattgaagcagttgcagctatgtctgtaatggacgtt
gtagaactgatctctgcaatggaagaaaaattcggtgtttccgctgctgctgctgtagct
gtagctgctggcccggttgaagctgctgaagaaaaaactgaattcgacgtaattctgaaa
gctgctggcgctaacaaagttgctgttatcaaagcagtacgtggcgcaactggcctgggt
ctgaaagaagctaaagacctggtagaatctgcaccggctgctctgaaagaaggcgtgagc
aaagacgacgcagaagcactgaaaaaagctctggaagaagctggcgctgaagttgaagtt
aaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 121 |
|---|
| Protein Molecular Weight: | 12295 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1CTF |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >50S ribosomal protein L7/L12
MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILK
AAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEV
K |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|