Identification |
---|
Name: | 50S ribosomal protein L7/L12 |
---|
Synonyms: | Not Available |
---|
Gene Name: | rplL |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | translation |
---|
Specific Function: | The binding site for several of the GTPase factors involved in protein synthesis (IF-2, EF-Tu, EF-G and RF3). Is thus essential for accurate translation. Deletion of 1 of the L12 dimers from the ribosome (by deleting the binding site on L10) leads to decreased IF-2 association with the 70S ribosome and decreased stimulation of the GTPase activity of EF-G. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cytosolic large ribosomal subunit | structural constituent of ribosome | translation |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >366
atgtctatcactaaagatcaaatcattgaagcagttgcagctatgtctgtaatggacgtt
gtagaactgatctctgcaatggaagaaaaattcggtgtttccgctgctgctgctgtagct
gtagctgctggcccggttgaagctgctgaagaaaaaactgaattcgacgtaattctgaaa
gctgctggcgctaacaaagttgctgttatcaaagcagtacgtggcgcaactggcctgggt
ctgaaagaagctaaagacctggtagaatctgcaccggctgctctgaaagaaggcgtgagc
aaagacgacgcagaagcactgaaaaaagctctggaagaagctggcgctgaagttgaagtt
aaataa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 121 |
---|
Protein Molecular Weight: | 12295 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1CTF |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >50S ribosomal protein L7/L12
MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILK
AAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEV
K |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|