| Identification |
|---|
| Name: | ATP-dependent protease subunit HslV |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | hslV |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | response to heat |
|---|
| Specific Function: | Protease subunit of a proteasome-like degradation complex believed to be a general protein degrading machinery. The complex has been shown to be involved in the specific degradation of heat shock induced transcription factors such as RpoH and SulA. In addition, small hydrophobic peptides are also hydrolyzed by HslV. HslV has weak protease activity even in the absence of HslU, but this activity is induced more than 100-fold in the presence of HslU. HslU recognizes protein substrates and unfolds these before guiding them to HslV for hydrolysis. HslV is not believed to degrade folded proteins. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosol | | HslUV protease complex | | identical protein binding | | metal ion binding | | proteasome core complex | | proteolysis involved in cellular protein catabolic process | | response to heat | | threonine-type endopeptidase activity |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >531
gtgacaactatagtaagcgtacgccgtaacggccatgtggtcatcgctggtgatggtcag
gccacgttgggcaataccgtaatgaaaggcaacgtgaaaaaggtccgccgtctgtacaac
gacaaagtcatcgcgggctttgcgggcggtactgcggatgcttttacgctgttcgaactg
tttgaacgtaaactggaaatgcatcagggccatctggtcaaagccgccgttgagctggca
aaagactggcgtaccgatcgcatgctgcgcaaacttgaagcactgctggcagtcgcggat
gaaactgcatcgcttatcatcaccggtaacggtgacgtggtgcagccagaaaacgatctt
attgctatcggctccggcggcccttacgcccaggctgcggcgcgcgcgctgttagaaaac
actgaacttagcgcccgtgaaattgctgaaaaggcgttggatattgcaggcgacatttgc
atctataccaaccatttccacaccatcgaagaattaagctacaaagcgtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 176 |
|---|
| Protein Molecular Weight: | 19092 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1E94 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >ATP-dependent protease subunit HslV
MTTIVSVRRNGHVVIAGDGQATLGNTVMKGNVKKVRRLYNDKVIAGFAGGTADAFTLFEL
FERKLEMHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADETASLIITGNGDVVQPENDL
IAIGSGGPYAQAAARALLENTELSAREIAEKALDIAGDICIYTNHFHTIEELSYKA |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|