| Identification |
|---|
| Name: | Large-conductance mechanosensitive channel |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | mscL |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | ion transport |
|---|
| Specific Function: | Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer. Participates in the regulation of osmotic pressure changes within the cell. Forms a nonselective ion channel of 2.5 nanosiemens conductance. Opens at a pressure just below that which would cause cell disruption and death. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| identical protein binding | | integral component of membrane | | ion transmembrane transport | | ion transport | | mechanically-gated ion channel activity | | membrane | | plasma membrane |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >411
atgagcattattaaagaatttcgcgaatttgcgatgcgcgggaacgtggtggatttggcg
gtgggtgtcattatcggtgcggcattcgggaagattgtctcttcactggttgccgatatc
atcatgcctcctctgggcttattaattggcgggatcgattttaaacagtttgctgtcacg
ctacgcgatgcgcagggggatatccctgctgttgtgatgcattacggtgtcttcattcaa
aacgtctttgattttctgattgtggcctttgccatctttatggcgattaagctaatcaac
aaactgaatcggaaaaaagaagaaccagcagccgcacctgcaccaactaaagaagaagta
ttactgacagaaattcgtgatttgctgaaagagcagaataaccgctcttaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 136 |
|---|
| Protein Molecular Weight: | 14956 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1KYK |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Large-conductance mechanosensitive channel
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT
LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV
LLTEIRDLLKEQNNRS |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
