| Identification |
|---|
| Name: | RNA-binding protein Hfq |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | hfq |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | regulation of transcription, DNA-templated |
|---|
| Specific Function: | RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Involved in the regulation of stress responses mediated by the sigma factors RpoS, sigma-E and sigma-32 (PubMed:17158661). Binds with high specificity to tRNAs (PubMed:18230766). Binds sRNA antitoxin RalA (PubMed:24748661). In vitro, stimulates synthesis of long tails by poly(A) polymerase I (PubMed:10677490). Required for RNA phage Qbeta replication (PubMed:805130). Seems to play a role in persister cell formation; upon overexpression decreases persister cell formation while deletion increases persister formation (PubMed:19909729). |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| bent DNA binding | | negative regulation of translation, ncRNA-mediated | | positive regulation of translation, ncRNA-mediated | | regulation of transcription, DNA-templated | | RNA binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >309
atggctaaggggcaatctttacaagatccgttcctgaacgcactgcgtcgggaacgtgtt
ccagtttctatttatttggtgaatggtattaagctgcaagggcaaatcgagtcttttgat
cagttcgtgatcctgttgaaaaacacggtcagccagatggtttacaagcacgcgatttct
actgttgtcccgtctcgcccggtttctcatcacagtaacaacgccggtggcggtaccagc
agtaactaccatcatggtagcagcgcgcagaatacttccgcgcaacaggacagcgaagaa
accgaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 102 |
|---|
| Protein Molecular Weight: | 11166 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1HK9 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >RNA-binding protein Hfq
MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS
TVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
