| Identification |
|---|
| Name: | Primosomal replication protein n |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | priB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | plasmid maintenance |
|---|
| Specific Function: | Binds single-stranded DNA at the primosome assembly site (PAS). During primosome assembly it facilitates the complex formation between PriA and DnaT. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| DNA replication initiation | | DNA replication, synthesis of RNA primer | | plasmid maintenance | | primosome complex | | single-stranded DNA binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >315
atgaccaaccgtctggtgttgtccggcaccgtgtgcagggctccccttcgaaaggtcagt
ccatcaggaattcctcactgccagttcgtgcttgagcatcgttctgtgcaggaggaagcc
ggctttcaccggcaggcgtggtgtcaaatgcccgttattgttagcggacacgaaaaccag
gccattactcacagtataacggtcggcagtcgcataaccgttcaggggttcatttcatgc
cacaaggcaaagaacggactgagcaaaatggttttgcatgccgagcagattgaattgata
gattctggagactag |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 104 |
|---|
| Protein Molecular Weight: | 11442 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1TXY |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Primosomal replication protein n
MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQ
AITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
