Putative inhibitor of glucose uptake transporter sgrT (C1P5Z7)

Identification
Name:Putative inhibitor of glucose uptake transporter sgrT
Synonyms:Not Available
Gene Name:sgrT
Enzyme Class:Not Available
Biological Properties
General Function:Involved in phosphoenolpyruvate-dependent sugar phospho
Specific Function:Acts to promote recovery from glucose-phosphate stress due to intracellular accumulation of glucose-6-phosphate caused by disruption of glycolytic flux or in the presence of (toxic) non- metabolizable glucose phosphate analogs. It may do so by inhibiting the transporter activity for glucose uptake (ptsG) as cells that overexpress this protein do not seem to import glucose although they have nearly wild-type levels of ptsG
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:Not Available
Gene Properties
Blattner:b4662
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>132 bp
ATGCGTCAGTTTTATCAGCACTATTTTACCGCGACAGCGAAGTTGTGCTGGTTGCGTTGG
TTAAGCGTCCCACAACGATTAACCATGCTTGAAGGACTGATGCAGTGGGATGACCGCAAT
TCTGAAAGTTGA
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:43
Protein Molecular Weight:5338
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Putative inhibitor of glucose uptake transporter sgrT
MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES
References
External Links:
ResourceLink
Uniprot ID:C1P5Z7
Uniprot Name:SGRT_ECOLI
GenBank Gene ID:U00096
Genebank Protein ID:226510924
ColiBase:b4662
Kegg Gene:b4662
CCDB:SGRT_ECOLI
BacMap:226524697
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hemm, M. R., Paul, B. J., Schneider, T. D., Storz, G., Rudd, K. E. (2008). "Small membrane proteins found by comparative genomics and ribosome binding site models." Mol Microbiol 70:1487-1501. Pubmed: 19121005
  • Wadler, C. S., Vanderpool, C. K. (2007). "A dual function for a bacterial small RNA: SgrS performs base pairing-dependent regulation and encodes a functional polypeptide." Proc Natl Acad Sci U S A 104:20454-20459. Pubmed: 18042713