Identification
Name:Probable enoyl-CoA hydratase paaF
Synonyms:Not Available
Gene Name:paaF
Enzyme Class:
Biological Properties
General Function:Involved in catalytic activity
Specific Function:Could possibly oxidize fatty acids using specific components
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb3-Hydroxybutanoyl-CoA
Crotonoyl-CoA + Water ↔ 3-Hydroxybutanoyl-CoA
ReactionCard
Thumb+ThumbThumb
Thumb+ThumbThumb
(3S)-3-Hydroxyacyl-CoAThumb+trans-3-Enoyl-CoA+Thumb
(3S)-3-Hydroxyacyl-CoA ↔ trans-2,3-Dehydroacyl-CoA + trans-3-Enoyl-CoA + Water
ReactionCard
SMPDB Reactions:
Thumb+Thumb(3S)-3-hydroxyacyl-CoA +(3S)-3-Hydroxyacyl-CoA
Crotonoyl-CoA + Water → (3S)-3-hydroxyacyl-CoA + (3S)-3-Hydroxyacyl-CoA
ReactionCard
(2E)-5-Methylhexa-2,4-dienoyl-CoA+Thumb3-Hydroxy-5-methylhex-4-enoyl-CoA
(2E)-5-Methylhexa-2,4-dienoyl-CoA + Water → 3-Hydroxy-5-methylhex-4-enoyl-CoA
ReactionCard
Thumb+Thumb(3S)-3-Hydroxyadipyl-CoA
Water + 5-Carboxy-2-pentenoyl-CoA → (3S)-3-Hydroxyadipyl-CoA
ReactionCard
a trans-2-enoyl-CoA Thumb+(3S)-3-hydroxyacyl-CoA
a trans-2-enoyl-CoA  → Water + (3S)-3-hydroxyacyl-CoA
ReactionCard
(3S)-3-hydroxyacyl-CoA +ThumbThumb+Thumb+a 3-oxoacyl-CoA 
(3S)-3-hydroxyacyl-CoA + NADNADH + Hydrogen ion + a 3-oxoacyl-CoA 
ReactionCard
ThumbThumb+3-Hydroxybutyryl-CoA+Thumb
3-Hydroxybutyryl-CoA+Thumb+ThumbThumb+Thumb+Acetoacetyl-CoA+Thumb
3-Hydroxybutyryl-CoA + NAD + 3-Hydroxybutyryl-CoANADH + Hydrogen ion + Acetoacetyl-CoA + Acetoacetyl-CoA
ReactionCard
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+(S)-Hydroxyoctanoyl-CoA+Thumb
(S)-Hydroxyoctanoyl-CoA+Thumb+Thumb ? Thumb+Thumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
trans-Octadec-2-enoyl-CoA+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+3-Oxooctadecanoyl-CoA+Thumb
ThumbThumb
2,3-didehydroadipyl-CoA+ThumbThumb
2,3-didehydroadipyl-CoA + Water3-Hydroxyadipyl-CoA
ReactionCard
EcoCyc Reactions:
Thumb2,3-dehydroadipyl-CoA+Thumb
3-Hydroxyadipyl-CoA ↔ 2,3-dehydroadipyl-CoA + Water
ReactionCard
Complex Reactions:
(3S)-3-hydroxyacyl-CoAtrans-2(or 3)-enoyl-CoA+Thumb
(3S)-3-hydroxyacyl-CoA → trans-2(or 3)-enoyl-CoA + Water
ReactionCard
(3S)-3-hydroxyacyl-CoAtrans-2(or 3)-enoyl-CoA+Thumb
(3S)-3-hydroxyacyl-CoA → trans-2(or 3)-enoyl-CoA + Water
ReactionCard
(3S)-3-hydroxyacyl-CoAtrans-2(or 3)-enoyl-CoA+Thumb
(3S)-3-hydroxyacyl-CoA → trans-2(or 3)-enoyl-CoA + Water
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB20008(2E)-5-Methylhexa-2,4-dienoyl-CoAMetaboCard
ECMDB03948(2E)-Decenoyl-CoAMetaboCard
ECMDB03712(2E)-Dodecenoyl-CoAMetaboCard
ECMDB03945(2E)-Hexadecenoyl-CoAMetaboCard
ECMDB03949(2E)-Octenoyl-CoAMetaboCard
ECMDB03946(2E)-Tetradecenoyl-CoAMetaboCard
ECMDB20010(3S)-3-Hydroxyadipyl-CoAMetaboCard
ECMDB21642(S)-3-Hydroxybutanoyl-CoAMetaboCard
ECMDB03936(S)-3-Hydroxydodecanoyl-CoAMetaboCard
ECMDB03932(S)-3-Hydroxyhexadecanoyl-CoAMetaboCard
ECMDB01052(S)-3-Hydroxyisobutyryl-CoAMetaboCard
ECMDB21101(S)-3-Hydroxyoctadecanoyl-CoAMetaboCard
ECMDB03934(S)-3-Hydroxytetradecanoyl-CoAMetaboCard
ECMDB03938(S)-Hydroxydecanoyl-CoAMetaboCard
ECMDB03942(S)-Hydroxyhexanoyl-CoAMetaboCard
ECMDB03940(S)-Hydroxyoctanoyl-CoAMetaboCard
ECMDB231592-(1,2-Epoxy-1,2-dihydrophenyl)acetyl-CoAMetaboCard
ECMDB211642-Oxepin-2(3H)-ylideneacetyl-CoAMetaboCard
ECMDB200713-Hydroxy-5-methylhex-4-enoyl-CoAMetaboCard
ECMDB202313-Hydroxyadipyl-CoAMetaboCard
ECMDB011663-Hydroxybutyryl-CoAMetaboCard
ECMDB068703-Hydroxyisovaleryl-CoAMetaboCard
ECMDB014933-Methylcrotonyl-CoAMetaboCard
ECMDB039393-Oxodecanoyl-CoAMetaboCard
ECMDB039373-Oxododecanoyl-CoAMetaboCard
ECMDB064023-Oxohexadecanoyl-CoAMetaboCard
ECMDB039433-Oxohexanoyl-CoAMetaboCard
ECMDB211703-Oxooctadecanoyl-CoAMetaboCard
ECMDB039413-Oxooctanoyl-CoAMetaboCard
ECMDB039353-Oxotetradecanoyl-CoAMetaboCard
ECMDB201015-Carboxy-2-pentenoyl-CoAMetaboCard
ECMDB01484Acetoacetyl-CoAMetaboCard
ECMDB02307Acrylyl-CoAMetaboCard
ECMDB02009Crotonoyl-CoAMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB01011Methacrylyl-CoAMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB02054Tiglyl-CoAMetaboCard
ECMDB03944trans-2-Hexenoyl-CoAMetaboCard
ECMDB21363Trans-Octadec-2-enoyl-CoAMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
Process
metabolic process
Gene Properties
Blattner:b1393
Gene OrientationClockwise
Centisome Percentage:31.37
Left Sequence End1455521
Right Sequence End1456288
Gene Sequence:
>768 bp
ATGTGCGAATTGCTCGGGATGAGCGCCAACGTCCCTACCGATATCTGCTTTAGTTTCACC
GGGCTTGTACAGCGTGGTGGTGGAACCGGGCCACATAAAGATGGCTGGGGCATTACCTTT
TACGAAGGTAAAGGCTGTCGCACATTTAAAGATCCACAACCCAGCTTTAATTCCCCCATC
GCCAAACTTGTCCAGGACTACCCGATAAAATCCTGTTCGGTGGTGGCTCATATTCGCCAG
GCTAATCGGGGCGAGGTGGCGCTGGAAAATACTCACCCATTTACCCGCGAGTTATGGGGG
CGTAACTGGACTTATGCCCATAACGGACAACTGACGGGCTACAAATCACTGGAAACCGGC
AACTTCCGCCCGGTAGGCGAAACCGACAGCGAAAAAGCCTTCTGCTGGCTCCTGCATAAA
TTAACGCAGCGTTACCCGCGCACACCGGGCAACATGGCGGCGGTATTTAAATATATCGCC
TCACTGGCGGATGAACTGCGGCAGAAGGGCGTTTTCAACATGCTGCTTTCGGACGGGCGC
TATGTAATGGCGTATTGCTCGACTAATTTACACTGGATCACCCGCCGCGCGCCGTTTGGC
GTGGCAACGTTGCTGGATCAGGATGTGGAAATCGACTTCAGCTCGCAGACCACACCGAAT
GATGTGGTCACGGTGATTGCAACACAGCCGCTGACGGGCAATGAAACCTGGCAAAAGATT
ATGCCAGGCGAATGGCGCTTATTTTGCCTCGGGGAGCGTGTAGTTTGA
Protein Properties
Pfam Domain Function:
Protein Residues:255
Protein Molecular Weight:27237
Protein Theoretical pI:8
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Probable enoyl-CoA hydratase paaF
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
References
External Links:
ResourceLink
Uniprot ID:P76082
Uniprot Name:PAAF_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4902959
Ecogene ID:EG13740
Ecocyc:EG13740
ColiBase:b1393
Kegg Gene:b1393
EchoBASE ID:EB3503
CCDB:PAAF_ECOLI
BacMap:16129354
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Ferrandez, A., Garcia, J. L., Diaz, E. (2000). "Transcriptional regulation of the divergent paa catabolic operons for phenylacetic acid degradation in Escherichia coli." J Biol Chem 275:12214-12222. Pubmed: 10766858
  • Ferrandez, A., Minambres, B., Garcia, B., Olivera, E. R., Luengo, J. M., Garcia, J. L., Diaz, E. (1998). "Catabolism of phenylacetic acid in Escherichia coli. Characterization of a new aerobic hybrid pathway." J Biol Chem 273:25974-25986. Pubmed: 9748275
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553