Identification
Name:Fatty acid oxidation complex subunit alpha
Synonyms:
  • Enoyl-CoA hydratase/Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase
  • 3-hydroxyacyl-CoA dehydrogenase
Gene Name:fadB
Enzyme Class:
Biological Properties
General Function:Involved in 3-hydroxyacyl-CoA dehydrogenase activity
Specific Function:Catalyzes the formation of an hydroxyacyl-CoA by addition of water on enoyl-CoA. Also exhibits 3-hydroxyacyl-CoA epimerase and 3-hydroxyacyl-CoA dehydrogenase activities. Involved in the aerobic and anaerobic degradation of long-chain fatty acids
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
Transports:
Transport References:
  • Orth, J. D., Conrad, T. M., Na, J., Lerman, J. A., Nam, H., Feist, A. M., Palsson, B. O. (2011). "A comprehensive genome-scale reconstruction of Escherichia coli metabolism--2011." Mol Syst Biol 7:535. Pubmed: 21988831
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
ThumbThumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
(S)-3-Hydroxyisobutyrate+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb
(6Z,9Z,12Z,15Z,18Z,21Z)-3-Hydroxytetracosahexa-6,9,12,15,18,21-enoyl-CoA(2E,6Z,9Z,12Z,15Z,18Z,21Z)-Tetracosahepta-2,6,9,12,15,18,21-enoyl-CoA+Thumb
(6Z,9Z,12Z,15Z,18Z,21Z)-3-Hydroxytetracosahexa-6,9,12,15,18,21-enoyl-CoA ↔ (2E,6Z,9Z,12Z,15Z,18Z,21Z)-Tetracosahepta-2,6,9,12,15,18,21-enoyl-CoA + Water
ReactionCard
(6Z,9Z,12Z,15Z,18Z)-3-Hydroxytetracosapenta-6,9,12,15,18-enoyl-CoA(2E,6Z,9Z,12Z,15Z,18Z)-Tetracosahexa-2,6,9,12,15,18-enoyl-CoA+Thumb
(6Z,9Z,12Z,15Z,18Z)-3-Hydroxytetracosapenta-6,9,12,15,18-enoyl-CoA ↔ (2E,6Z,9Z,12Z,15Z,18Z)-Tetracosahexa-2,6,9,12,15,18-enoyl-CoA + Water
ReactionCard
Thumb+ThumbThumb
Thumb+ThumbThumb+Thumb+Thumb
(3S)-3-Hydroxyacyl-CoAThumb+trans-3-Enoyl-CoA+Thumb
(3S)-3-Hydroxyacyl-CoA ↔ trans-2,3-Dehydroacyl-CoA + trans-3-Enoyl-CoA + Water
ReactionCard
(3S)-3-Hydroxyacyl-CoA+ThumbThumb+Thumb+Thumb
(3S)-3-Hydroxyacyl-CoA + NAD3-Oxoacyl-CoA + NADH + Hydrogen ion
ReactionCard
Complex Reactions:
ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb
(S)-3-hydroxyacyl-CoA+Thumb3-oxoacyl-CoA+Thumb
(S)-3-hydroxyacyl-CoA + NAD → 3-oxoacyl-CoA + NADH
ReactionCard
(3S)-3-hydroxyacyl-CoAtrans-2(or 3)-enoyl-CoA+Thumb
(3S)-3-hydroxyacyl-CoA → trans-2(or 3)-enoyl-CoA + Water
ReactionCard
Thumb(R)-3-hydroxybutanoyl-CoA
3-Hydroxybutyryl-CoA → (R)-3-hydroxybutanoyl-CoA
ReactionCard
(3S)-3-hydroxyacyl-CoAtrans-2(or 3)-enoyl-CoA+Thumb
(3S)-3-hydroxyacyl-CoA → trans-2(or 3)-enoyl-CoA + Water
ReactionCard
(S)-3-hydroxyacyl-CoA+Thumb3-oxoacyl-CoA+Thumb
(S)-3-hydroxyacyl-CoA + NAD → 3-oxoacyl-CoA + NADH
ReactionCard
Thumb(R)-3-hydroxybutanoyl-CoA
3-Hydroxybutyryl-CoA → (R)-3-hydroxybutanoyl-CoA
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB20008(2E)-5-Methylhexa-2,4-dienoyl-CoAMetaboCard
ECMDB03948(2E)-Decenoyl-CoAMetaboCard
ECMDB03712(2E)-Dodecenoyl-CoAMetaboCard
ECMDB03945(2E)-Hexadecenoyl-CoAMetaboCard
ECMDB03949(2E)-Octenoyl-CoAMetaboCard
ECMDB03946(2E)-Tetradecenoyl-CoAMetaboCard
ECMDB20010(3S)-3-Hydroxyadipyl-CoAMetaboCard
ECMDB23150(3Z)-Dodec-3-enoyl-CoAMetaboCard
ECMDB21642(S)-3-Hydroxybutanoyl-CoAMetaboCard
ECMDB03936(S)-3-Hydroxydodecanoyl-CoAMetaboCard
ECMDB03932(S)-3-Hydroxyhexadecanoyl-CoAMetaboCard
ECMDB01052(S)-3-Hydroxyisobutyryl-CoAMetaboCard
ECMDB21101(S)-3-Hydroxyoctadecanoyl-CoAMetaboCard
ECMDB03934(S)-3-Hydroxytetradecanoyl-CoAMetaboCard
ECMDB03938(S)-Hydroxydecanoyl-CoAMetaboCard
ECMDB03942(S)-Hydroxyhexanoyl-CoAMetaboCard
ECMDB03940(S)-Hydroxyoctanoyl-CoAMetaboCard
ECMDB02217(S)-Methylmalonic acid semialdehydeMetaboCard
ECMDB011572-Methylacetoacetyl-CoAMetaboCard
ECMDB200713-Hydroxy-5-methylhex-4-enoyl-CoAMetaboCard
ECMDB011663-Hydroxybutyryl-CoAMetaboCard
ECMDB068703-Hydroxyisovaleryl-CoAMetaboCard
ECMDB014933-Methylcrotonyl-CoAMetaboCard
ECMDB200773-Oxoadipyl-CoAMetaboCard
ECMDB039393-Oxodecanoyl-CoAMetaboCard
ECMDB039373-Oxododecanoyl-CoAMetaboCard
ECMDB064023-Oxohexadecanoyl-CoAMetaboCard
ECMDB039433-Oxohexanoyl-CoAMetaboCard
ECMDB211703-Oxooctadecanoyl-CoAMetaboCard
ECMDB039413-Oxooctanoyl-CoAMetaboCard
ECMDB039353-Oxotetradecanoyl-CoAMetaboCard
ECMDB201015-Carboxy-2-pentenoyl-CoAMetaboCard
ECMDB201045-Methyl-3-oxo-4-hexenoyl-CoAMetaboCard
ECMDB01484Acetoacetyl-CoAMetaboCard
ECMDB02307Acrylyl-CoAMetaboCard
ECMDB02009Crotonoyl-CoAMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB01011Methacrylyl-CoAMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB21260Octadecenoyl-CoA (N-C18:1CoA)MetaboCard
ECMDB02054Tiglyl-CoAMetaboCard
ECMDB11123trans,cis-Lauro-2,6-dienoyl-CoAMetaboCard
ECMDB03944trans-2-Hexenoyl-CoAMetaboCard
ECMDB21363Trans-Octadec-2-enoyl-CoAMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
fatty acid beta-oxidation multienzyme complex
macromolecular complex
protein complex
Function
3-hydroxyacyl-CoA dehydrogenase activity
3-hydroxybutyryl-CoA epimerase activity
binding
carbon-oxygen lyase activity
catalytic activity
coenzyme binding
cofactor binding
dodecenoyl-CoA delta-isomerase activity
enoyl-CoA hydratase activity
hydro-lyase activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, transposing C=C bonds
isomerase activity
lyase activity
oxidoreductase activity
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
racemase and epimerase activity
racemase and epimerase activity, acting on hydroxy acids and derivatives
Process
carboxylic acid metabolic process
cellular metabolic process
fatty acid catabolic process
fatty acid metabolic process
lipid catabolic process
lipid metabolic process
metabolic process
monocarboxylic acid metabolic process
organic acid metabolic process
oxidation reduction
oxoacid metabolic process
primary metabolic process
Gene Properties
Blattner:b3846
Gene OrientationCounterclockwise
Centisome Percentage:86.79
Left Sequence End4026805
Right Sequence End4028994
Gene Sequence:
>2190 bp
ATGCTTTACAAAGGCGACACCCTGTACCTTGACTGGCTGGAAGATGGCATTGCCGAACTG
GTATTTGATGCCCCAGGTTCAGTTAATAAACTCGACACTGCGACCGTCGCCAGCCTCGGC
GAGGCCATCGGCGTGCTGGAACAGCAATCAGATCTAAAAGGGCTGCTGCTGCGTTCGAAC
AAAGCAGCCTTTATCGTCGGTGCTGATATCACCGAATTTTTGTCCCTGTTCCTCGTTCCT
GAAGAACAGTTAAGTCAGTGGCTGCACTTTGCCAATAGCGTGTTTAATCGCCTGGAAGAT
CTGCCGGTGCCGACCATTGCTGCCGTCAATGGCTATGCGCTGGGCGGTGGCTGCGAATGC
GTGCTGGCGACCGATTATCGTCTGGCGACGCCGGATCTGCGCATCGGTCTGCCGGAAACC
AAACTGGGCATCATGCCTGGCTTTGGCGGTTCTGTACGTATGCCACGTATGCTGGGCGCT
GACAGTGCGCTGGAAATCATTGCCGCCGGTAAAGATGTCGGCGCGGATCAGGCGCTGAAA
ATCGGTCTGGTGGATGGCGTAGTCAAAGCAGAAAAACTGGTTGAAGGCGCAAAGGCGGTT
TTACGCCAGGCCATTAACGGCGACCTCGACTGGAAAGCAAAACGTCAGCCGAAGCTGGAA
CCACTAAAACTGAGCAAGATTGAAGCCACCATGAGCTTCACCATCGCTAAAGGGATGGTC
GCACAAACAGCGGGGAAACATTATCCGGCCCCCATCACCGCAGTAAAAACCATTGAAGCT
GCGGCCCGTTTTGGTCGTGAAGAAGCCTTAAACCTGGAAAACAAAAGTTTTGTCCCGCTG
GCGCATACCAACGAAGCCCGCGCACTGGTCGGCATTTTCCTTAACGATCAATATGTAAAA
GGCAAAGCGAAGAAACTCACCAAAGACGTTGAAACCCCGAAACAGGCCGCGGTGCTGGGT
GCAGGCATTATGGGCGGCGGCATCGCTTACCAGTCTGCGTGGAAAGGCGTGCCGGTTGTC
ATGAAAGATATCAACGACAAGTCGTTAACCCTCGGCATGACCGAAGCCGCGAAACTGCTG
AACAAGCAGCTTGAGCGCGGCAAGATCGATGGTCTGAAACTGGCTGGCGTGATCTCCACA
ATCCACCCAACGCTCGACTACGCCGGATTTGACCGCGTGGATATTGTGGTAGAAGCGGTT
GTTGAAAACCCGAAAGTGAAAAAAGCCGTACTGGCAGAAACCGAACAAAAAGTACGCCAG
GATACCGTGCTGGCGTCTAACACTTCAACCATTCCTATCAGCGAACTGGCCAACGCGCTG
GAACGCCCGGAAAACTTCTGCGGGATGCACTTCTTTAACCCGGTCCACCGAATGCCGTTG
GTAGAAATTATTCGCGGCGAGAAAAGCTCCGACGAAACCATCGCGAAAGTTGTCGCCTGG
GCGAGCAAGATGGGCAAGACGCCGATTGTGGTTAACGACTGCCCCGGCTTCTTTGTTAAC
CGCGTGCTGTTCCCGTATTTCGCCGGTTTCAGCCAGCTGCTGCGCGACGGCGCGGATTTC
CGCAAGATCGACAAAGTGATGGAAAAACAGTTTGGCTGGCCGATGGGCCCGGCATATCTG
CTGGACGTTGTGGGCATTGATACCGCGCATCACGCTCAGGCTGTCATGGCAGCAGGCTTC
CCGCAGCGGATGCAGAAAGATTACCGCGATGCCATCGACGCGCTGTTTGATGCCAACCGC
TTTGGTCAGAAGAACGGCCTCGGTTTCTGGCGTTATAAAGAAGACAGCAAAGGTAAGCCG
AAGAAAGAAGAAGACGCCGCCGTTGAAGACCTGCTGGCAGAAGTGAGCCAGCCGAAGCGC
GATTTCAGCGAAGAAGAGATTATCGCCCGCATGATGATCCCGATGGTCAACGAAGTGGTG
CGCTGTCTGGAGGAAGGCATTATCGCCACTCCGGCGGAAGCGGATATGGCGCTGGTCTAC
GGCCTGGGCTTCCCTCCGTTCCACGGCGGCGCGTTCCGCTGGCTGGACACCCTCGGTAGC
GCAAAATACCTCGATATGGCACAGCAATATCAGCACCTCGGCCCGCTGTATGAAGTGCCG
GAAGGTCTGCGTAATAAAGCGCGTCATAACGAACCGTACTATCCTCCGGTTGAGCCAGCC
CGTCCGGTTGGCGACCTGAAAACGGCTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:729
Protein Molecular Weight:79593
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Fatty acid oxidation complex subunit alpha
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQKVRQ
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVEDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
References
External Links:
ResourceLink
Uniprot ID:P21177
Uniprot Name:FADB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676207
Ecogene ID:EG10279
Ecocyc:EG10279
ColiBase:b3846
Kegg Gene:b3846
EchoBASE ID:EB0275
CCDB:FADB_ECOLI
BacMap:16131692
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Campbell, J. W., Morgan-Kiss, R. M., Cronan, J. E. Jr (2003). "A new Escherichia coli metabolic competency: growth on fatty acids by a novel anaerobic beta-oxidation pathway." Mol Microbiol 47:793-805. Pubmed: 12535077
  • Daniels, D. L., Plunkett, G. 3rd, Burland, V., Blattner, F. R. (1992). "Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes." Science 257:771-778. Pubmed: 1379743
  • DiRusso, C. C. (1990). "Primary sequence of the Escherichia coli fadBA operon, encoding the fatty acid-oxidizing multienzyme complex, indicates a high degree of homology to eucaryotic enzymes." J Bacteriol 172:6459-6468. Pubmed: 1699931
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Nakahigashi, K., Inokuchi, H. (1990). "Nucleotide sequence of the fadA and fadB genes from Escherichia coli." Nucleic Acids Res 18:4937. Pubmed: 2204034
  • Yang, X. Y., Schulz, H., Elzinga, M., Yang, S. Y. (1991). "Nucleotide sequence of the promoter and fadB gene of the fadBA operon and primary structure of the multifunctional fatty acid oxidation protein from Escherichia coli." Biochemistry 30:6788-6795. Pubmed: 1712230