Identification
Name:Probable quinol monooxygenase ygiN
Synonyms:
  • QuMo
Gene Name:ygiN
Enzyme Class:Not Available
Biological Properties
General Function:Involved in oxidoreductase activity
Specific Function:Can oxidize menadiol to menadione
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
Thumb+2 Thumb2 Thumb+Menaquinone 8+2 Thumb
2 Thumb+Thumb2 Thumb+2 Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB21225Hydrogen ionMetaboCard
ECMDB21550MenadiolMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB04124OxygenMetaboCard
ECMDB21285Superoxide anionMetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
catalytic activity
oxidoreductase activity
Process
antibiotic biosynthetic process
antibiotic metabolic process
cellular metabolic process
drug metabolic process
metabolic process
Gene Properties
Blattner:b3029
Gene OrientationClockwise
Centisome Percentage:68.35
Left Sequence End3171164
Right Sequence End3171478
Gene Sequence:
>315 bp
ATGTTTAAAAAAGGCTTACTTGCTCTGGCACTGGTGTTTTCACTGCCCGTTTTCGCCGCT
GAACACTGGATCGATGTTCGTGTTCCAGAGCAGTATCAGCAAGAGCACGTTCAGGGGGCC
ATCAATATTCCCCTGAAGGAAGTGAAAGAGCGCATTGCCACCGCCGTTCCGGATAAAAAC
GACACCGTGAAAGTGTATTGCAATGCCGGACGCCAGTCAGGGCAAGCAAAAGAGATCCTT
AGCGAGATGGGATATACCCACGTTGAGAACGCCGGTGGCCTGAAAGACATCGCAATGCCG
AAGGTCAAAGGTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:104
Protein Molecular Weight:11532
Protein Theoretical pI:6
PDB File:1R6Y
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Probable quinol monooxygenase ygiN
MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSI
VMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPGI
References
External Links:
ResourceLink
Uniprot ID:P0ADU2
Uniprot Name:YGIN_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1742138
PDB ID:1R6Y
Ecogene ID:EG12657
Ecocyc:EG12657
ColiBase:b3029
Kegg Gene:b3029
EchoBASE ID:EB2525
CCDB:YGIN_ECOLI
BacMap:16130925
General Reference:
  • Adams, M. A., Jia, Z. (2005). "Structural and biochemical evidence for an enzymatic quinone redox cycle in Escherichia coli: identification of a novel quinol monooxygenase." J Biol Chem 280:8358-8363. Pubmed: 15613473
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Chatterjee, P. K., Sternberg, N. L. (1995). "A general genetic approach in Escherichia coli for determining the mechanism(s) of action of tumoricidal agents: application to DMP 840, a tumoricidal agent." Proc Natl Acad Sci U S A 92:8950-8954. Pubmed: 7568050
  • Fountoulakis, M., Takacs, M. F., Berndt, P., Langen, H., Takacs, B. (1999). "Enrichment of low abundance proteins of Escherichia coli by hydroxyapatite chromatography." Electrophoresis 20:2181-2195. Pubmed: 10493123
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
  • Wasinger, V. C., Humphery-Smith, I. (1998). "Small genes/gene-products in Escherichia coli K-12." FEMS Microbiol Lett 169:375-382. Pubmed: 9868784
  • Wilkins, M. R., Gasteiger, E., Tonella, L., Ou, K., Tyler, M., Sanchez, J. C., Gooley, A. A., Walsh, B. J., Bairoch, A., Appel, R. D., Williams, K. L., Hochstrasser, D. F. (1998). "Protein identification with N and C-terminal sequence tags in proteome projects." J Mol Biol 278:599-608. Pubmed: 9600841