Identification
Name:Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase
Synonyms:
  • Apo-ACP nucleodityltransferase
  • Holo-ACP synthase
  • Holo-citrate lyase synthase
Gene Name:citX
Enzyme Class:
Biological Properties
General Function:Involved in prosthetic group biosynthetic process
Specific Function:Transfers 2-(5''-triphosphoribosyl)-3'- dephosphocoenzyme-A on a serine residue to the apo-acyl carrier protein (gamma chain) of the citrate lyase to yield holo-acyl carrier protein
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb
SMPDB Reactions:
Thumb+ [an apo citrate-lyase acyl-carrier protein]Pyrophosphate+Thumb+[a holo citrate lyase acyl-carrier protein]
2'-(5-Triphosphoribosyl)-3'-dephospho-CoA + [an apo citrate-lyase acyl-carrier protein] → Pyrophosphate + Hydrogen ion + [a holo citrate lyase acyl-carrier protein]
ReactionCard
EcoCyc Reactions:
ThumbThumb+Thumb
Complex Reactions:
Thumb+citrate lyase apo-[acyl-carrier-protein]citrate lyase holo-[acyl-carrier-protein]+Thumb
2'-(5-Triphosphoribosyl)-3'-dephospho-CoA + citrate lyase apo-[acyl-carrier-protein] → citrate lyase holo-[acyl-carrier-protein] + Pyrophosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB202232'-(5-Triphosphoribosyl)-3'-dephospho-CoAMetaboCard
ECMDB00042Acetic acidMetaboCard
ECMDB00094Citric acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00223Oxalacetic acidMetaboCard
ECMDB04142PyrophosphateMetaboCard
GO Classification:
Process
biosynthetic process
cellular biosynthetic process
cofactor biosynthetic process
metabolic process
prosthetic group biosynthetic process
Gene Properties
Blattner:b0614
Gene OrientationCounterclockwise
Centisome Percentage:13.94
Left Sequence End646707
Right Sequence End647258
Gene Sequence:
>552 bp
ATGTTGTTAGAACAGGGGTGGCTGGTTGGCGCGCGCCGCGTTCCCTCACCACATTACGAT
TGCCGCCCGGATGACGAAACACCCACCCTGCTGGTGGTGCACAATATTAGCCTGCCGCCA
GGCGAGTTTGGCGGTCCGTGGATCGACGCATTATTCACTGGAACTATTGATCCGCAGGCA
CATCCTTTCTTTGCTGAGATCGCCCATTTGCGCGTCTCCGCTCACTGTTTGATTCGCCGT
GATGGTGAAATAGTCCAGTATGTTCCTTTCGATAAACGTGCATGGCATGCGGGAGTCTCT
CAGTATCAGGGGCGCGAACGCTGCAATGATTTTTCTATTGGGATTGAGCTTGAAGGCACC
GATACGCTGGCGTATACCGATGCGCAGTATCAACAGCTTGCGGCGGTTACGCGGGCACTG
ATTGATTGCTATCCGGATATCGCTAAAAACATGACGGGCCATTGTGATATTGCGCCGGAT
CGGAAAACCGATCCCGGTCCTGCATTTGATTGGGCACGGTTTCGTGTGCTGGTCAGCAAG
GAGACAACATGA
Protein Properties
Pfam Domain Function:
Protein Residues:183
Protein Molecular Weight:20270
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase
MHLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTVVAPGPIKDSEVTRRI
FNHGVTALRALAAKQGWQIQEQAALVSASGPEGMLSIAAPARDLKLATIELEHSHPLGRL
WDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCARGKTHQLTDLLNRMEALLNDVDAC
NVN
References
External Links:
ResourceLink
Uniprot ID:P0A6G5
Uniprot Name:CITX_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21238958
Ecogene ID:EG13540
Ecocyc:EG13540
ColiBase:b0614
Kegg Gene:b0614
EchoBASE ID:EB3310
CCDB:CITX_ECOLI
BacMap:16128597
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Pos, K. M., Dimroth, P., Bott, M. (1998). "The Escherichia coli citrate carrier CitT: a member of a novel eubacterial transporter family related to the 2-oxoglutarate/malate translocator from spinach chloroplasts." J Bacteriol 180:4160-4165. Pubmed: 9696764
  • Schneider, K., Dimroth, P., Bott, M. (2000). "Biosynthesis of the prosthetic group of citrate lyase." Biochemistry 39:9438-9450. Pubmed: 10924139
  • Schneider, K., Dimroth, P., Bott, M. (2000). "Identification of triphosphoribosyl-dephospho-CoA as precursor of the citrate lyase prosthetic group." FEBS Lett 483:165-168. Pubmed: 11042274