Identification
Name:Valine--pyruvate aminotransferase
Synonyms:
  • Alanine--valine transaminase
  • Transaminase C
Gene Name:avtA
Enzyme Class:
Biological Properties
General Function:Involved in transferase activity
Specific Function:L-valine + pyruvate = 3-methyl-2-oxobutanoate + L-alanine
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
L-Valine+Thumb+ThumbL-Alanine+Thumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb+Thumb
an aminated amine donor+Thumb+Thumb ? 2-aminobutyrate+a deaminated amine donor
an aminated amine donor + 2-Ketobutyric acid + Hydrogen ion ? 2-aminobutyrate + a deaminated amine donor
ReactionCard
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB00019a-Ketoisovaleric acidMetaboCard
ECMDB04092alpha-Ketoisovaleric acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00161L-AlanineMetaboCard
ECMDB00883L-ValineMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Function
binding
catalytic activity
cofactor binding
pyridoxal phosphate binding
transferase activity
transferase activity, transferring nitrogenous groups
Process
biosynthetic process
metabolic process
Gene Properties
Blattner:b3572
Gene OrientationClockwise
Centisome Percentage:80.56
Left Sequence End3737728
Right Sequence End3738981
Gene Sequence:
>1254 bp
ATGCTGGAACAAATGGGCATTGCCGCGAAGCAAGCCTCGTATAAATTAGCGCAACTCTCC
AGCCGCGAAAAAAATCGCGTGCTGGAAAAAATCGCCGATGAACTGGAAGCACAAAGCGAA
ATCATCCTCAACGCTAACGCCCAGGATGTTGCTGACGCGCGAGCCAATGGCCTTAGCGAA
GCGATGCTTGACCGTCTGGCACTGACGCCCGCACGGCTGAAAGGCATTGCCGACGATGTA
CGTCAGGTGTGCAACCTCGCCGATCCGGTGGGGCAGGTAATCGATGGCGGCGTACTGGAC
AGCGGCCTGCGTCTTGAGCGTCGTCGCGTACCGCTGGGGGTTATTGGCGTGATTTATGAA
GCGCGCCCGAACGTGACGGTTGATGTCGCTTCGCTGTGCCTGAAAACCGGTAATGCGGTG
ATCCTGCGCGGTGGCAAAGAAACGTGTCGCACTAACGCTGCAACGGTGGCGGTGATTCAG
GACGCCCTGAAATCCTGCGGCTTACCGGCGGGTGCCGTGCAGGCGATTGATAATCCTGAC
CGTGCGCTGGTCAGTGAAATGCTGCGTATGGATAAATACATCGACATGCTGATCCCGCGT
GGTGGCGCTGGTTTGCATAAACTGTGCCGTGAACAGTCGACAATCCCGGTGATCACAGGT
GGTATAGGCGTATGCCATATTTACGTTGATGAAAGTGTAGAGATCGCTGAAGCATTAAAA
GTGATCGTCAACGCGAAAACTCAGCGTCCGAGCACATGTAATACGGTTGAAACGTTGCTG
GTGAATAAAAACATCGCCGATAGCTTCCTGCCCGCATTAAGCAAACAAATGGCGGAAAGC
GGCGTGACATTACACGCAGATGCAGCTGCACTGGCGCAGTTGCAGGCAGGCCCTGCGAAG
GTGGTTGCTGTTAAAGCCGAAGAGTATGACGATGAGTTTCTGTCATTAGATTTGAACGTC
AAAATCGTCAGCGATCTTGACGATGCCATCGCCCATATTCGTGAACACGGCACACAACAC
TCCGATGCGATCCTGACCCGCGATATGCGCAACGCCCAGCGTTTTGTTAACGAAGTGGAT
TCGTCCGCTGTTTACGTTAACGCCTCTACGCGTTTTACCGACGGCGGCCAGTTTGGTCTG
GGTGCGGAAGTGGCGGTAAGCACACAAAAACTCCACGCGCGTGGCCCAATGGGGCTGGAA
GCACTGACCACTTACAAGTGGATCGGCATTGGTGATTACACCATTCGTGCGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:417
Protein Molecular Weight:46711
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Valine--pyruvate aminotransferase
MTFSLFGDKFTRHSGITLLMEDLNDGLRTPGAIMLGGGNPAQIPEMQDYFQTLLTDMLES
GKATDALCNYDGPQGKTELLTLLAGMLREKLGWDIEPQNIALTNGSQSAFFYLFNLFAGR
RADGRVKKVLFPLAPEYIGYADAGLEEDLFVSARPNIELLPEGQFKYHVDFEHLHIGEET
GMICVSRPTNPTGNVITDEELLKLDALANQHGIPLVIDNAYGVPFPGIIFSEARPLWNPN
IVLCMSLSKLGLPGSRCGIIIANEKIITAITNMNGIISLAPGGIGPAMMCEMIKRNDLLR
LSETVIKPFYYQRVQETIAIIRRYLPENRCLIHKPEGAIFLWLWFKDLPITTKQLYQRLK
ARGVLMVPGHNFFPGLDKPWPHTHQCMRMNYVPEPEKIEAGVKILAEEIERAWAESH
References
External Links:
ResourceLink
Uniprot ID:P09053
Uniprot Name:AVTA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674395
Ecogene ID:EG10107
Ecocyc:EG10107
ColiBase:b3572
Kegg Gene:b3572
EchoBASE ID:EB0105
CCDB:AVTA_ECOLI
BacMap:49176374
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Liu, L., Whalen, W., Das, A., Berg, C. M. (1987). "Rapid sequencing of cloned DNA using a transposon for bidirectional priming: sequence of the Escherichia coli K-12 avtA gene." Nucleic Acids Res 15:9461-9469. Pubmed: 2825136
  • Riley, M., Abe, T., Arnaud, M. B., Berlyn, M. K., Blattner, F. R., Chaudhuri, R. R., Glasner, J. D., Horiuchi, T., Keseler, I. M., Kosuge, T., Mori, H., Perna, N. T., Plunkett, G. 3rd, Rudd, K. E., Serres, M. H., Thomas, G. H., Thomson, N. R., Wishart, D., Wanner, B. L. (2006). "Escherichia coli K-12: a cooperatively developed annotation snapshot--2005." Nucleic Acids Res 34:1-9. Pubmed: 16397293
  • Sofia, H. J., Burland, V., Daniels, D. L., Plunkett, G. 3rd, Blattner, F. R. (1994). "Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes." Nucleic Acids Res 22:2576-2586. Pubmed: 8041620