Identification
Name:Taurine transport system permease protein tauC
Synonyms:Not Available
Gene Name:tauC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transporter activity
Specific Function:Part of a binding-protein-dependent transport system for taurine. Probably responsible for the translocation of the substrate across the membrane
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
KEGG Pathways:
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
SMPDB Reactions:
Thumb+Thumb+ThumbThumb+Adenosine diphosphate+Thumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21313ButanesulfonateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21233Isethionic acidMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00251TaurineMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
membrane
Function
transporter activity
Process
establishment of localization
transport
Gene Properties
Blattner:b0367
Gene OrientationClockwise
Centisome Percentage:8.32
Left Sequence End386195
Right Sequence End387022
Gene Sequence:
>828 bp
ATGAGTGTGCTCATTAATGAAAAACTGCATTCGCGGCGGCTGAAATGGCGCTGGCCGCTC
TCGCGTCAGGTGACCTTAAGCATTGGCACGTTAGCGGTTTTACTCACCGTATGGTGGACG
GTGGCGACGCTGCAACTGATTAGCCCGCTATTTTTGCCGCCGCCGCAACAGGTACTGGAA
AAACTACTCACCATTGCCGGACCGCAAGGCTTTATGGACGCCACGCTGTGGCAGCATCTG
GCAGCCAGTCTGACGCGCATTATGCTGGCGCTATTTGCAGCGGTGTTGTTCGGTATTCCG
GTCGGGATCGCGATGGGACTTAGCCCTACGGTACGCGGCATTCTGGATCCGATAATCGAG
CTTTATCGTCCGGTGCCGCCGCTGGCTTATTTGCCGCTGATGGTGATCTGGTTTGGTATT
GGTGAAACCTCGAAGATCTTACTGATCTATTTAGCGATTTTTGCACCGGTGGCGATGTCG
GCGCTGGCGGGGGTGAAAAGCGTGCAGCAGGTTCGCATTCGTGCCGCCCAGTCGCTGGGT
GCCAGCCGTGCGCAGGTGCTGTGGTTTGTCATTTTGCCCGGTGCGCTGCCGGAAATCCTC
ACCGGATTACGTATTGGTCTGGGGGTGGGCTGGTCTACGCTGGTGGCGGCGGAGCTGATT
GCCGCGACGCGCGGTTTAGGATTTATGGTTCAGTCAGCGGGTGAATTTCTCGCAACTGAC
GTGGTGCTGGCGGGGATCGCGGTGATTGCGATTATCGCCTTTCTTTTAGAACTGGGTCTG
CGCGCGTTACAGCGCCGCCTGACGCCCTGGCATGGAGAAGTACAATGA
Protein Properties
Pfam Domain Function:
Protein Residues:275
Protein Molecular Weight:29812
Protein Theoretical pI:11
Signaling Regions:
  • None
Transmembrane Regions:
  • 20-42
  • 87-107
  • 124-144
  • 146-166
  • 186-206
  • 209-229
  • 236-256
Protein Sequence:
>Taurine transport system permease protein tauC
MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVATLQLISPLFLPPPQQVLE
KLLTIAGPQGFMDATLWQHLAASLTRIMLALFAAVLFGIPVGIAMGLSPTVRGILDPIIE
LYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALAGVKSVQQVRIRAAQSLG
ASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAATRGLGFMVQSAGEFLATD
VVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ
References
External Links:
ResourceLink
Uniprot ID:Q47539
Uniprot Name:TAUC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674508
Ecogene ID:EG13301
Ecocyc:EG13301
ColiBase:b0367
Kegg Gene:b0367
EchoBASE ID:EB3086
CCDB:TAUC_ECOLI
BacMap:16128352
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • van der Ploeg, J. R., Weiss, M. A., Saller, E., Nashimoto, H., Saito, N., Kertesz, M. A., Leisinger, T. (1996). "Identification of sulfate starvation-regulated genes in Escherichia coli: a gene cluster involved in the utilization of taurine as a sulfur source." J Bacteriol 178:5438-5446. Pubmed: 8808933