Identification
Name:Acetyl-CoA acetyltransferase
Synonyms:
  • Acetoacetyl-CoA thiolase
Gene Name:atoB
Enzyme Class:
Biological Properties
General Function:Involved in transferase activity, transferring acyl groups other than amino-acyl groups
Specific Function:2 acetyl-CoA = CoA + acetoacetyl-CoA
Cellular Location:Cytoplasm (Potential)
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
2 ThumbThumb+Thumb
2 ThumbThumb+Thumb
Thumb+Butanoyl-CoAThumb+Thumb
SMPDB Reactions:
ThumbThumb+Thumb
EcoCyc Reactions:
2 ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB039433-Oxohexanoyl-CoAMetaboCard
ECMDB01484Acetoacetyl-CoAMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB01088Butyryl-CoAMetaboCard
ECMDB01423Coenzyme AMetaboCard
GO Classification:
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Process
metabolic process
Gene Properties
Blattner:b2224
Gene OrientationClockwise
Centisome Percentage:50.09
Left Sequence End2324131
Right Sequence End2325315
Gene Sequence:
>1185 bp
ATGAAAAATTGTGTCATCGTCAGTGCGGTACGTACTGCTATCGGTAGTTTTAACGGTTCA
CTCGCTTCCACCAGCGCCATCGACCTGGGGGCGACAGTAATTAAAGCCGCCATTGAACGT
GCAAAAATCGATTCACAACACGTTGATGAAGTGATTATGGGTAACGTGTTACAAGCCGGG
CTGGGGCAAAATCCGGCGCGTCAGGCACTGTTAAAAAGCGGGCTGGCAGAAACGGTGTGC
GGATTCACGGTCAATAAAGTATGTGGTTCGGGTCTTAAAAGTGTGGCGCTTGCCGCCCAG
GCCATTCAGGCAGGTCAGGCGCAGAGCATTGTGGCGGGGGGTATGGAAAATATGAGTTTA
GCCCCCTACTTACTCGATGCAAAAGCACGCTCTGGTTATCGTCTTGGAGACGGACAGGTT
TATGACGTAATCCTGCGCGATGGCCTGATGTGCGCCACCCATGGTTATCATATGGGGATT
ACCGCCGAAAACGTGGCTAAAGAGTACGGAATTACCCGTGAAATGCAGGATGAACTGGCG
CTACATTCACAGCGTAAAGCGGCAGCCGCAATTGAGTCCGGTGCTTTTACAGCCGAAATC
GTCCCGGTAAATGTTGTCACTCGAAAGAAAACCTTCGTCTTCAGTCAAGACGAATTCCCG
AAAGCGAATTCAACGGCTGAAGCGTTAGGTGCATTGCGCCCGGCCTTCGATAAAGCAGGA
ACAGTCACCGCTGGGAACGCGTCTGGTATTAACGACGGTGCTGCCGCTCTGGTGATTATG
GAAGAATCTGCGGCGCTGGCAGCAGGCCTTACCCCCCTGGCTCGCATTAAAAGTTATGCC
AGCGGTGGCGTGCCCCCCGCATTGATGGGTATGGGGCCAGTACCTGCCACGCAAAAAGCG
TTACAACTGGCGGGGCTGCAACTGGCGGATATTGATCTCATTGAGGCTAATGAAGCATTT
GCTGCACAGTTCCTTGCCGTTGGGAAAAACCTGGGCTTTGATTCTGAGAAAGTGAATGTC
AACGGCGGGGCCATCGCGCTCGGGCATCCTATCGGTGCCAGTGGTGCTCGTATTCTGGTC
ACACTATTACATGCCATGCAGGCACGCGATAAAACGCTGGGGCTGGCAACACTGTGCATT
GGCGGCGGTCAGGGAATTGCGATGGTGATTGAACGGTTGAATTAA
Protein Properties
Pfam Domain Function:
Protein Residues:394
Protein Molecular Weight:40352
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Acetyl-CoA acetyltransferase
MKNCVIVSAVRTAIGSFNGSLASTSAIDLGATVIKAAIERAKIDSQHVDEVIMGNVLQAG
LGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAIQAGQAQSIVAGGMENMSL
APYLLDAKARSGYRLGDGQVYDVILRDGLMCATHGYHMGITAENVAKEYGITREMQDELA
LHSQRKAAAAIESGAFTAEIVPVNVVTRKKTFVFSQDEFPKANSTAEALGALRPAFDKAG
TVTAGNASGINDGAAALVIMEESAALAAGLTPLARIKSYASGGVPPALMGMGPVPATQKA
LQLAGLQLADIDLIEANEAFAAQFLAVGKNLGFDSEKVNVNGGAIALGHPIGASGARILV
TLLHAMQARDKTLGLATLCIGGGQGIAMVIERLN
References
External Links:
ResourceLink
Uniprot ID:P76461
Uniprot Name:ATOB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1736879
Ecogene ID:EG11672
Ecocyc:EG11672
ColiBase:b2224
Kegg Gene:b2224
EchoBASE ID:EB1623
CCDB:ATOB_ECOLI
BacMap:16130161
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Itoh, T., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Kasai, H., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Seki, Y., Horiuchi, T., et, a. l. .. (1996). "A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map." DNA Res 3:379-392. Pubmed: 9097040