Identification
Name:Acetate CoA-transferase subunit beta
Synonyms:
  • Acetyl-CoA:acetoacetate-CoA transferase subunit beta
Gene Name:atoA
Enzyme Class:
Biological Properties
General Function:Involved in CoA-transferase activity
Specific Function:Acyl-CoA + acetate = a fatty acid anion + acetyl-CoA
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Butanoyl-CoA+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Acyl-CoA+ThumbFatty acid anion+Thumb
Acyl-CoA + Acetic acid ↔ Fatty acid anion + Acetyl-CoA
ReactionCard
SMPDB Reactions:
Thumb+ThumbThumb+3-Hydroxy-5-oxohexanoyl-CoA+Thumb
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
a 2,3,4-saturated fatty acyl CoA+Thumba fatty acid+Thumb
a 2,3,4-saturated fatty acyl CoA + Acetic acid ↔ a fatty acid + Acetyl-CoA
ReactionCard
Complex Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Acyl-CoA+Thumba fatty acid anion+Thumb
Acyl-CoA + Acetic acid → a fatty acid anion + Acetyl-CoA
ReactionCard
Acyl-CoA+Thumba fatty acid anion+Thumb
Acyl-CoA + Acetic acid → a fatty acid anion + Acetyl-CoA
ReactionCard
Acyl-CoA+Thumba fatty acid anion+Thumb
Acyl-CoA + Acetic acid → a fatty acid anion + Acetyl-CoA
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB200723-Hydroxy-5-oxohexanoateMetaboCard
ECMDB200733-Hydroxy-5-oxohexanoyl-CoAMetaboCard
ECMDB00042Acetic acidMetaboCard
ECMDB00060Acetoacetic acidMetaboCard
ECMDB01484Acetoacetyl-CoAMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB00039Butyric acidMetaboCard
ECMDB01088Butyryl-CoAMetaboCard
ECMDB21229Hexanoate (N-C6:0)MetaboCard
ECMDB02845Hexanoyl-CoAMetaboCard
GO Classification:
Function
catalytic activity
CoA-transferase activity
transferase activity
transferase activity, transferring sulfur-containing groups
Process
metabolic process
Gene Properties
Blattner:b2222
Gene OrientationClockwise
Centisome Percentage:50.05
Left Sequence End2322131
Right Sequence End2322781
Gene Sequence:
>651 bp
ATGAAAGTATCAGTTCCAGGCATGCCGGTTACACTTTTAAATATGAGCAAGAACGATATT
TATAAGATGGTGAGCGGGGACAAGATGGACGTGAAGATGAATATCTTTCAACGCTTGTGG
GAGACGTTACGCCATCTGTTCTGGTCAGATAAACAGACTGAGGCTTATAAACTTCTGTTC
AATTTCGTGAATAACCAGACTGGCAACATCAACGCCTCAGAATACTTTACTGGGGCTATC
AACGAGAATGAGAGAGAAAAGTTTATCAATAGCCTGGAATTATTCAATAAACTTAAAACA
TGCGCAAAAAATCCGGATGAGTTGGTCGCAAAGGGCAATATGCGCTGGGTCGCCCAGACC
TTCGGGGATATCGAGTTAAGTGTCACTTTTTTCATTGAAAAGAATAAGATATGTACTCAG
ACGTTGCAGCTGCATAAGGGCCAAGGTAACTTGGGCGTTGATCTTAGAAAGGCTTACCTT
CCCGGCGTTGACATGAGGGATTGTTACCTTGGTAAAAAAACAATGAAAGGTAGCAATGAT
ATCCTTTATGAGAGACCTGGGTGGAATGCTAACCTGGGCGTGCTACCCCGGACGGTGCTA
CCCCGGACGGTGCTAACCCGGACGGTGCTAACCTGGACGGTGCTACCGTGA
Protein Properties
Pfam Domain Function:
Protein Residues:216
Protein Molecular Weight:22960
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Acetate CoA-transferase subunit beta
MDAKQRIARRVAQELRDGDIVNLGIGLPTMVANYLPEGIHITLQSENGFLGLGPVTTAHP
DLVNAGGQPCGVLPGAAMFDSAMSFALIRGGHIDACVLGGLQVDEEANLANWVVPGKMVP
GMGGAMDLVTGSRKVIIAMEHCAKDGSAKILRRCTMPLTAQHAVHMLVTELAVFRFIDGK
MWLTEIADGCDLATVRAKTEARFEVAADLNTQRGDL
References
External Links:
ResourceLink
Uniprot ID:P76459
Uniprot Name:ATOA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674305
Ecogene ID:EG11670
Ecocyc:EG11670
ColiBase:b2222
Kegg Gene:b2222
EchoBASE ID:EB1621
CCDB:ATOA_ECOLI
BacMap:16130159
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Itoh, T., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Kasai, H., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Seki, Y., Horiuchi, T., et, a. l. .. (1996). "A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map." DNA Res 3:379-392. Pubmed: 9097040