Identification
Name:Imidazole glycerol phosphate synthase subunit hisH
Synonyms:
  • IGP synthase glutamine amidotransferase subunit
  • IGP synthase subunit hisH
  • ImGP synthase subunit hisH
  • IGPS subunit hisH
Gene Name:hisH
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transferase activity, transferring pentosyl groups
Specific Function:IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The hisH subunit provides the glutamine amidotransferase activity that produces the ammonia necessary to hisF for the synthesis of IGP and AICAR
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
Thumb+ThumbL-Glutamic acid+Thumb+Thumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB200985-Amino-4-imidazolecarboxyamideMetaboCard
ECMDB01517AICARMetaboCard
ECMDB12208D-Erythro-imidazole-glycerol-phosphateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00148L-GlutamateMetaboCard
ECMDB00641L-GlutamineMetaboCard
ECMDB01317N5-Carboxyaminoimidazole ribonucleotideMetaboCard
ECMDB01439Phosphoribosyl formamidocarboxamideMetaboCard
ECMDB12278Phosphoribulosylformimino-AICAR-PMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring pentosyl groups
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
glutamine family amino acid metabolic process
glutamine metabolic process
histidine biosynthetic process
histidine family amino acid metabolic process
histidine metabolic process
metabolic process
Gene Properties
Blattner:b2023
Gene OrientationClockwise
Centisome Percentage:45.10
Left Sequence End2092559
Right Sequence End2093149
Gene Sequence:
>591 bp
ATGCAGTCTGAACGTATTTATTTGGTATGGGCCCATCCTCGTCATGATTCATTGACCGCA
CATATTGCTGATGCGATCCATCAGCGGGCAATGGAGCGGAAAATACAGGTGACGGAACTC
GATTTATATCGGCGTAATTTCAACCCAGTGATGACGCCGGAAGATGAACCAGACTGGAAG
AATATGGATAAACGTTATTCTCCAGAGGTTCATCAGCTTTATTCAGAGCTGCTTGAACAT
GACACGTTAGTGGTGGTTTTTCCTCTCTGGTGGTACAGCTTCCCGGCAATGCTAAAAGGA
TATATTGACAGAGTATGGAATAATGGGCTGGCTTATGGAGATGGGCACAAATTACCATTC
AATAAAGTTCGTTGGGTGGCGCTGGTTGGAGGAGACAAAGAATCATTTGTCCAGATGGGC
TGGGAAAAAAATATAAGCGATTATTTAAAAAATATGTGCAGTTATCTTGGTATTGAAGAT
GCCGATGTCACTTTCTTGTGTAATACAGTGGTATTCGATGGGGAAGAACTTCACGCGAGC
TATTATCAGTCGTTATTATCTCAGGTACGGGATATGGTAGATGCACTATAA
Protein Properties
Pfam Domain Function:
Protein Residues:196
Protein Molecular Weight:21653
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Imidazole glycerol phosphate synthase subunit hisH
MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRER
ELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNR
VYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPE
RSGAAGAKLLKNFLEM
References
External Links:
ResourceLink
Uniprot ID:P60595
Uniprot Name:HIS5_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062477
Ecogene ID:EG10450
Ecocyc:EG10450
ColiBase:b2023
Kegg Gene:b2023
EchoBASE ID:EB0445
CCDB:HIS5_ECOLI
BacMap:16129964
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Carlomagno, M. S., Chiariotti, L., Alifano, P., Nappo, A. G., Bruni, C. B. (1988). "Structure and function of the Salmonella typhimurium and Escherichia coli K-12 histidine operons." J Mol Biol 203:585-606. Pubmed: 3062174
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Itoh, T., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Kasai, H., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Seki, Y., Horiuchi, T., et, a. l. .. (1996). "A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map." DNA Res 3:379-392. Pubmed: 9097040
  • Klem, T. J., Davisson, V. J. (1993). "Imidazole glycerol phosphate synthase: the glutamine amidotransferase in histidine biosynthesis." Biochemistry 32:5177-5186. Pubmed: 8494895
  • O'Donoghue, P., Amaro, R. E., Luthey-Schulten, Z. (2001). "On the structure of hisH: protein structure prediction in the context of structural and functional genomics." J Struct Biol 134:257-268. Pubmed: 11551184