Identification
Name:Spermidine N(1)-acetyltransferase
Synonyms:
  • Diamine acetyltransferase
  • SAT
Gene Name:speG
Enzyme Class:
Biological Properties
General Function:Involved in N-acetyltransferase activity
Specific Function:Regulates polyamine concentration by their degradation. Acts on spermidine, forming N(1)- and N(8)-acetylspermidine
Cellular Location:Cytoplasm (Potential)
SMPDB Pathways:
  • S-adenosyl-L-methionine biosynthesis PW000837
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbThumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB01206Acetyl-CoAMetaboCard
ECMDB01423Coenzyme AMetaboCard
ECMDB20274EthylenediamineMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB02064N-AcetylputrescineMetaboCard
ECMDB01276N1-AcetylspermidineMetaboCard
ECMDB21254N8-AcetylspermidineMetaboCard
ECMDB01414PutrescineMetaboCard
ECMDB01257SpermidineMetaboCard
GO Classification:
Function
acetyltransferase activity
acyltransferase activity
catalytic activity
N-acetyltransferase activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Process
metabolic process
Gene Properties
Blattner:b1584
Gene OrientationClockwise
Centisome Percentage:35.65
Left Sequence End1654208
Right Sequence End1654768
Gene Sequence:
>561 bp
ATGAACGTGAGTAAATATGTCGCTATCTTTTCCTTTGTTTTTATTCAGTTAATCAGCGTT
GGTAAAGTTTTTGCTAACGCAGATGAGTGGATGACAACGTTTAGAGAAAATATTGCACAA
ACCTGGCAACAGCCTGAACATTATGATTTATATATTCCTGCCATCACCTGGCATGCACGT
TTCGCTTACGACAAAGAAAAAACCGATCGCTATAACGAGCGACCGTGGGGTGGCGGTTTT
GGCCTGTCGCGTTGGGATGAAAAAGGAAACTGGCATGGCCTGTATGCCATGGCATTTAAG
GACTCGTGGAACAAATGGGAACCGATTGCCGGATACGGATGGGAAAGTACCTGGCGACCG
CTGGCGGATGAAAATTTTCATTTAGGTCTGGGATTCACCGCTGGCGTAACGGCACGCGAT
AACTGGAATTACATCCCTCTCCCGGTTCTACTGCCATTGGCCTCCGTGGGTTATGGCCCA
GTGACTTTTCAGATGACCTACATTCCGGGTACCTACAACAATGGCAATGTGTACTTTGCC
TGGATGCGCTTTCAGTTTTGA
Protein Properties
Pfam Domain Function:
Protein Residues:186
Protein Molecular Weight:21887
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Spermidine N(1)-acetyltransferase
MPSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRF
VVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKL
YLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCIFQHQYLAEHKTPGQTL
LKPTAQ
References
External Links:
ResourceLink
Uniprot ID:P0A951
Uniprot Name:ATDA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674727
Ecogene ID:EG12447
Ecocyc:EG12447
ColiBase:b1584
Kegg Gene:b1584
EchoBASE ID:EB2341
CCDB:ATDA_ECOLI
BacMap:16129542
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Fukuchi, J., Kashiwagi, K., Takio, K., Igarashi, K. (1994). "Properties and structure of spermidine acetyltransferase in Escherichia coli." J Biol Chem 269:22581-22585. Pubmed: 8077207
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553