Identification
Name:Potassium-transporting ATPase C chain
Synonyms:
  • ATP phosphohydrolase [potassium-transporting] C chain
  • Potassium-binding and translocating subunit C
  • Potassium-translocating ATPase C chain
Gene Name:kdpC
Enzyme Class:
Biological Properties
General Function:Involved in potassium-transporting ATPase activity
Specific Function:One of the components of the high-affinity ATP-driven potassium transport (or KDP) system, which catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions. The C subunit may be involved in assembly of the KDP complex
Cellular Location:Cell inner membrane; Single-pass membrane protein (Probable)
SMPDB Pathways:Not Available
KEGG Pathways:
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Complex Reactions:
Thumb+Thumb+K(+)(Out)Thumb+Thumb+K(+)(In)
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB04139PotassiumMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
membrane
Function
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
ion transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
potassium ion transmembrane transporter activity
potassium-transporting ATPase activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
cation transport
establishment of localization
ion transport
monovalent inorganic cation transport
potassium ion transport
transport
Gene Properties
Blattner:b0696
Gene OrientationCounterclockwise
Centisome Percentage:15.60
Left Sequence End723630
Right Sequence End724202
Gene Sequence:
>573 bp
ATGAAACTCGTGCACATGGCCAGTGGTTTAGCGGTTGCGATTGCGTTGGCGGCTTGCGCA
GATAAAAGCGCGGATATTCAGACGCCAGCACCGGCTGCAAATACGTCTATTTCAGCAACA
CAACAACCAGCTATCCAGCAACCGAATGTCTCCGGTACCGTCTGGATCCGTCAGAAAGTC
GCACTGCCGCCTGATGCTGTGCTGACCGTGACACTTTCTGACGCGTCGTTAGCCGATGCA
CCGTCAAAAGTGCTGGCGCAGAAAGCGGTGCGTACTGAAGGTAAACAGTCACCATTCAGC
TTTGTTCTGTCATTTAACCCGGCAGATGTTCAGCCGAACGCGCGTATTCTGTTGAGTGCG
GCGATTACCGTGAATGACAAACTGGTATTTATCACCGATACCGTTCAGCCGGTGATCAAC
CAGGGCGGAACTAAAGCCGACCTGACATTGGTGCCGGTACAGCAAACCGCCGTGCCGGTT
CAGGCCAGCGGTGGCGCAACGACTACCGTACCTTCGACTTCACCAACTCAGGTGAATCCG
TCTTCGGCAGTTCCAGCTCCTACGCAATATTAA
Protein Properties
Pfam Domain Function:
Protein Residues:190
Protein Molecular Weight:20267
Protein Theoretical pI:8
Signaling Regions:
  • None
Transmembrane Regions:
  • 10-30
Protein Sequence:
>Potassium-transporting ATPase C chain
MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFT
GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASVPVEL
VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE
LNLALDKLDE
References
External Links:
ResourceLink
Uniprot ID:P03961
Uniprot Name:ATKC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674593
Ecogene ID:EG10515
Ecocyc:EG10515
ColiBase:b0696
Kegg Gene:b0696
EchoBASE ID:EB0510
CCDB:ATKC_ECOLI
BacMap:16128672
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hesse, J. E., Wieczorek, L., Altendorf, K., Reicin, A. S., Dorus, E., Epstein, W. (1984). "Sequence homology between two membrane transport ATPases, the Kdp-ATPase of Escherichia coli and the Ca2+-ATPase of sarcoplasmic reticulum." Proc Natl Acad Sci U S A 81:4746-4750. Pubmed: 6146979
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232
  • Walderhaug, M. O., Polarek, J. W., Voelkner, P., Daniel, J. M., Hesse, J. E., Altendorf, K., Epstein, W. (1992). "KdpD and KdpE, proteins that control expression of the kdpABC operon, are members of the two-component sensor-effector class of regulators." J Bacteriol 174:2152-2159. Pubmed: 1532388