Identification
Name:Potassium-transporting ATPase B chain
Synonyms:
  • ATP phosphohydrolase [potassium-transporting] B chain
  • Potassium-binding and translocating subunit B
  • Potassium-translocating ATPase B chain
Gene Name:kdpB
Enzyme Class:
Biological Properties
General Function:Involved in nucleotide binding
Specific Function:One of the components of the high-affinity ATP-driven potassium transport (or KDP) system, which catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Complex Reactions:
Thumb+Thumb+K(+)(Out)Thumb+Thumb+K(+)(In)
Thumb+Thumb+K(+)(Out)Thumb+Thumb+K(+)(In)
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB04139PotassiumMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane
membrane part
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ATPase activity, coupled to transmembrane movement of ions
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
binding
catalytic activity
cation binding
cation transmembrane transporter activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
inorganic cation transmembrane transporter activity
ion binding
ion transmembrane transporter activity
magnesium ion binding
metal ion binding
monovalent inorganic cation transmembrane transporter activity
nucleoside binding
potassium ion transmembrane transporter activity
potassium-transporting ATPase activity
purine nucleoside binding
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
ATP biosynthetic process
cation transport
cellular nitrogen compound metabolic process
establishment of localization
ion transport
metabolic process
monovalent inorganic cation transport
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
potassium ion transport
purine nucleoside triphosphate biosynthetic process
purine nucleotide biosynthetic process
purine nucleotide metabolic process
purine ribonucleoside triphosphate biosynthetic process
transport
Gene Properties
Blattner:b0697
Gene OrientationCounterclockwise
Centisome Percentage:15.61
Left Sequence End724211
Right Sequence End726259
Gene Sequence:
>2049 bp
ATGAGTCGTAAACAACTGGCGCTATTCGAACCAACACTTGTCGTTCAGGCGCTGAAAGAA
GCGGTGAAAAAATTAAACCCGCAGGCGCAATGGCGCAATCCGGTGATGTTTATCGTCTGG
ATCGGCAGTCTGCTGACCACCTGTATTAGCATCGCGATGGCAAGCGGTGCGATGCCCGGC
AATGCGCTGTTTAGCGCGGCCATTAGCGGTTGGCTGTGGATCACCGTACTGTTCGCTAAT
TTCGCCGAGGCGCTGGCAGAAGGCCGCAGTAAAGCGCAGGCCAACAGTCTGAAAGGGGTG
AAAAAAACTGCCTTTGCCCGCAAGCTGCGTGAGCCGAAATATGGCGCTGCGGCGGACAAA
GTTCCTGCCGACCAACTTCGTAAAGGCGATATCGTACTGGTAGAAGCTGGCGATATTATC
CCCTGCGATGGTGAAGTTATTGAAGGGGGTGCATCGGTCGATGAAAGCGCCATCACCGGG
GAATCGGCACCGGTGATCCGTGAATCCGGCGGCGATTTTGCCTCCGTCACCGGCGGCACG
CGTATTCTTTCTGACTGGCTGGTGATTGAGTGTAGCGTTAACCCCGGCGAGACATTTCTG
GATCGGATGATCGCGATGGTGGAAGGCGCACAGCGACGCAAAACGCCGAACGAAATTGCC
CTGACCATTCTGCTGATTGCCCTGACTATCGTCTTTTTACTGGCAACCGCCACGCTGTGG
CCGTTTTCCGCGTGGGGCGGTAATGCAGTCAGCGTAACGGTACTGGTGGCGCTGCTGGTC
TGTCTGATCCCAACCACTATTGGCGGCCTGTTGTCAGCGATCGGCGTCGCCGGGATGAGC
CGGATGCTAGGCGCGAATGTGATTGCCACCAGCGGACGTGCAGTTGAAGCGGCAGGTGAC
GTTGACGTTCTGCTACTGGATAAAACCGGCACCATCACACTCGGTAACCGTCAGGCGTCG
GAGTTTATCCCCGCGCAGGGCGTGGATGAAAAAACGCTGGCTGACGCCGCACAACTGGCT
TCGCTGGCTGATGAAACGCCGGAAGGCCGCAGTATTGTGATCCTCGCCAAGCAGCGTTTT
AACCTGCGCGAGCGCGATGTGCAGTCGCTCCATGCCACCTTTGTACCGTTTACTGCGCAA
AGCCGGATGAGCGGGATCAACATCGACAACCGCATGATCCGTAAAGGTTCTGTCGATGCC
ATTCGTCGCCATGTTGAGGCTAACGGTGGTCACTTCCCTACCGATGTTGATCAAAAAGTC
GATCAGGTTGCGCGTCAGGGAGCCACGCCGCTGGTGGTGGTGGAAGGTTCTCGTGTGCTG
GGCGTTATTGCGCTGAAAGATATCGTCAAAGGCGGTATTAAAGAGCGCTTCGCCCAGCTG
CGCAAAATGGGCATTAAAACGGTGATGATTACCGGCGATAACCGTCTGACTGCCGCCGCG
ATTGCTGCGGAAGCGGGTGTCGATGATTTTCTCGCCGAAGCGACACCGGAGGCCAAGCTG
GCATTGATCCGTCAGTATCAGGCGGAAGGTCGTTTGGTAGCGATGACCGGCGACGGCACC
AACGATGCTCCGGCGCTGGCGCAGGCAGATGTCGCGGTGGCGATGAACTCCGGCACCCAG
GCGGCGAAAGAGGCGGGCAATATGGTCGATCTCGACTCTAACCCGACCAAGTTGATCGAG
GTGGTGCACATTGGCAAACAGATGCTGATGACCCGTGGCTCGCTGACCACCTTCAGCATT
GCCAACGATGTGGCGAAATACTTCGCCATTATTCCGGCGGCATTCGCGGCAACGTATCCG
CAGTTAAATGCGCTGAACATCATGTGCCTGCATTCGCCCGACTCCGCAATCCTCAGTGCG
GTGATTTTCAACGCCTTGATTATCGTCTTTTTGATTCCCCTGGCGTTAAAAGGCGTGAGT
TATAAACCGCTTACCGCTTCTGCCATGTTGCGCCGTAACTTATGGATTTACGGTCTGGGT
GGGCTGCTGGTGCCGTTTATCGGTATCAAAGTCATTGATTTACTGCTGACCGTTTGCGGT
CTGGTGTGA
Protein Properties
Pfam Domain Function:
Protein Residues:682
Protein Molecular Weight:72198
Protein Theoretical pI:8
PDB File:1X6K
Signaling Regions:
  • None
Transmembrane Regions:
  • 36-58
  • 63-85
  • 220-242
  • 252-274
  • 578-600
  • 615-634
  • 654-676
Protein Sequence:
>Potassium-transporting ATPase B chain
MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLLTTCISIAMASGAMPG
NALFSAAISGWLWITVLFANFAEALAEGRSKAQANSLKGVKKTAFARKLREPKYGAAADK
VPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGGDFASVTGGT
RILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALTILLIALTIVFLLATATLW
PFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSRMLGANVIATSGRAVEAAGD
VDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRF
NLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKV
DQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGDNRLTAAA
IAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAVAMNSGTQ
AAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFAATYP
QLNALNIMCLHSPDSAILSAVIFNALIIVFLIPLALKGVSYKPLTASAMLRRNLWIYGLG
GLLVPFIGIKVIDLLLTVCGLV
References
External Links:
ResourceLink
Uniprot ID:P03960
Uniprot Name:ATKB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674743
PDB ID:1X6K
Ecogene ID:EG10514
Ecocyc:EG10514
ColiBase:b0697
Kegg Gene:b0697
EchoBASE ID:EB0509
CCDB:ATKB_ECOLI
BacMap:16128673
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hesse, J. E., Wieczorek, L., Altendorf, K., Reicin, A. S., Dorus, E., Epstein, W. (1984). "Sequence homology between two membrane transport ATPases, the Kdp-ATPase of Escherichia coli and the Ca2+-ATPase of sarcoplasmic reticulum." Proc Natl Acad Sci U S A 81:4746-4750. Pubmed: 6146979
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232