Identification
Name:Potassium-transporting ATPase A chain
Synonyms:
  • ATP phosphohydrolase [potassium-transporting] A chain
  • Potassium-binding and translocating subunit A
  • Potassium-translocating ATPase A chain
Gene Name:kdpA
Enzyme Class:
Biological Properties
General Function:Involved in potassium-transporting ATPase activity
Specific Function:One of the components of the high-affinity ATP-driven potassium transport (or KDP) system, which catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Complex Reactions:
Thumb+Thumb+K(+)(Out)Thumb+Thumb+K(+)(In)
Thumb+Thumb+K(+)(Out)Thumb+Thumb+K(+)(In)
Thumb+Thumb+K(+)(Out)Thumb+Thumb+K(+)(In)
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB04139PotassiumMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
membrane
plasma membrane
Function
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
ion transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
potassium ion transmembrane transporter activity
potassium-transporting ATPase activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
cation transport
establishment of localization
ion transport
monovalent inorganic cation transport
potassium ion transport
transport
Gene Properties
Blattner:b0698
Gene OrientationCounterclockwise
Centisome Percentage:15.65
Left Sequence End726282
Right Sequence End727955
Gene Sequence:
>1674 bp
ATGGCTGCGCAAGGGTTCTTACTGATCGCCACGTTTTTACTGGTGTTAATGGTGCTGGCG
CGTCCTTTAGGCAGCGGGCTGGCGCGGCTGATTAATGACATTCCTCTTCCCGGTACAACG
GGCGTTGAGCGCGTACTTTTTCGCGCACTTGGCGTCTCTGACCGTGAGATGAACTGGAAG
CAATATCTTTGTGCCATTCTCGGCCTGAACATGCTGGGGCTGGCGGTGCTGTTTTTTATG
TTGCTCGGTCAGCACTATCTGCCGCTTAATCCACAGCAGTTGCCAGGGCTGTCGTGGGAT
CTGGCGCTGAATACCGCCGTCAGCTTTGTCACCAATACCAACTGGCAATCTTATAGCGGT
GAAACCACGTTGAGCTATTTCAGCCAGATGGCGGGCTTAACGGTGCAAAACTTTCTTTCT
GCCGCCAGCGGGATTGCGGTGATTTTTGCCCTCATCCGTGCGTTTACCCGCCAGAGCATG
AGCACGCTCGGGAATGCCTGGGTCGATCTGCTACGCATCACGTTATGGGTGCTAGTCCCT
GTGGCGTTGTTGATTGCACTGTTTTTTATTCAACAAGGTGCGCTGCAAAACTTTCTGCCT
TATCAGGCTGTGAATACCGTTGAAGGAGCGCAACAGCTGTTACCCATGGGGCCTGTAGCT
TCTCAGGAAGCGATCAAGATGCTCGGTACTAACGGCGGTGGCTTCTTTAATGCCAACTCG
TCGCATCCGTTTGAAAACCCAACCGCACTGACCAACTTCGTGCAGATGCTGGCGATCTTC
TTGATCCCAACGGCGCTGTGCTTTGCCTTTGGTGAAGTGATGGGCGATCGCCGCCAGGGG
CGCATGTTGCTGTGGGCGATGTCAGTGATTTTTGTCATCTGCGTAGGCGTGGTGATGTGG
GCAGAAGTTCAGGGTAATCCTCATCTGCTGGCACTGGGCACGGACAGCAGCATCAATATG
GAAGGTAAAGAGAGCCGTTTCGGCGTGCTGGTCAGTAGCCTGTTTGCGGTCGTGACGACG
GCGGCTTCCTGTGGCGCGGTGATTGCGATGCATGATTCGTTTACCGCTCTCGGTGGCATG
GTGCCGATGTGGCTGATGCAAATTGGTGAAGTGGTGTTCGGCGGTGTCGGTTCTGGTCTT
TACGGCATGATGCTGTTTGTCCTGCTGGCGGTGTTTATTGCCGGGCTGATGATTGGTCGT
ACACCGGAATATCTGGGTAAAAAAATCGACGTACGCGAGATGAAACTGACTGCACTGGCA
ATTCTGGTTACCCCGACGCTGGTGCTGATGGGCGCGGCGTTGGCGATGATGACCGACGCC
GGACGTAGCGCCATGCTCAACCCTGGCCCGCATGGTTTTAGCGAAGTGCTGTACGCCGTG
TCATCCGCCGCTAACAACAACGGCAGCGCCTTTGCCGGATTAAGCGCCAACTCTCCGTTC
TGGAACTGTTTACTGGCGTTCTGCATGTTTGTCGGTCGCTTCGGGGTGATTATCCCGGTG
ATGGCAATTGCCGGTTCGCTGGTGAGTAAAAAGAGCCAAGCCGCCAGCTCCGGCACGCTG
CCAACGCACGGCCCGCTGTTTGTTGGCCTGTTAATCGGCACCGTGTTGCTGGTTGGCGCA
CTGACCTTTATCCCTGCCCTGGCGCTTGGTCCGGTGGCGGAATATCTCTCCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:557
Protein Molecular Weight:59189
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • 6-26
  • 63-83
  • 132-152
  • 170-190
  • 253-273
  • 283-303
  • 329-349
  • 356-376
  • 379-399
  • 416-436
  • 484-504
  • 527-547
Protein Sequence:
>Potassium-transporting ATPase A chain
MAAQGFLLIATFLLVLMVLARPLGSGLARLINDIPLPGTTGVERVLFRALGVSDREMNWK
QYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALNTAVSFVTNTNWQSYSG
ETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTLGNAWVDLLRITLWVLVP
VALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQEAIKMLGTNGGGFFNANS
SHPFENPTALTNFVQMLAIFLIPTALCFAFGEVMGDRRQGRMLLWAMSVIFVICVGVVMW
AEVQGNPHLLALGTDSSINMEGKESRFGVLVSSLFAVVTTAASCGAVIAMHDSFTALGGM
VPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIGRTPEYLGKKIDVREMKLTALA
ILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLYAVSSAANNNGSAFAGLSANSPF
WNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQAASSGTLPTHGPLFVGLLIGTVLLVGA
LTFIPALALGPVAEYLS
References
External Links:
ResourceLink
Uniprot ID:P03959
Uniprot Name:ATKA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651307
Ecogene ID:EG10513
Ecocyc:EG10513
ColiBase:b0698
Kegg Gene:b0698
EchoBASE ID:EB0508
CCDB:ATKA_ECOLI
BacMap:16128674
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hesse, J. E., Wieczorek, L., Altendorf, K., Reicin, A. S., Dorus, E., Epstein, W. (1984). "Sequence homology between two membrane transport ATPases, the Kdp-ATPase of Escherichia coli and the Ca2+-ATPase of sarcoplasmic reticulum." Proc Natl Acad Sci U S A 81:4746-4750. Pubmed: 6146979
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232