Identification
Name:Homocysteine S-methyltransferase
Synonyms:
  • S-methylmethionine:homocysteine methyltransferase
Gene Name:mmuM
Enzyme Class:
Biological Properties
General Function:Involved in homocysteine S-methyltransferase activity
Specific Function:Catalyzes methyl transfer from S-methylmethionine or S- adenosylmethionine (less efficient) to homocysteine, selenohomocysteine and less efficiently selenocysteine
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+S-Methylmethionine2 Thumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+Thumb ? Thumb+Thumb+Thumb
S-methyl-L-methionine+Thumb ? Thumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+2 Thumb
Metabolites:
ECMDB IDNameView
ECMDB24053HomocysteineMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00165L-HomocysteineMetaboCard
ECMDB00696L-MethionineMetaboCard
ECMDB00939S-AdenosylhomocysteineMetaboCard
ECMDB01185S-AdenosylmethionineMetaboCard
ECMDB21377S-MethylmethionineMetaboCard
GO Classification:
Function
catalytic activity
homocysteine S-methyltransferase activity
methyltransferase activity
S-methyltransferase activity
transferase activity
transferase activity, transferring one-carbon groups
Gene Properties
Blattner:b0261
Gene OrientationClockwise
Centisome Percentage:5.95
Left Sequence End275939
Right Sequence End276871
Gene Sequence:
>933 bp
ATGGTTAAAGTTTATGCCCCGGCTTCCAGTGCCAATATGAGCGTCGGGTTTGATGTGCTC
GGGGCGGCGGTGACACCTGTTGATGGTGCATTGCTCGGAGATGTAGTCACGGTTGAGGCG
GCAGAGACATTCAGTCTCAACAACCTCGGACGCTTTGCCGATAAGCTGCCGTCAGAACCA
CGGGAAAATATCGTTTATCAGTGCTGGGAGCGTTTTTGCCAGGAACTGGGTAAGCAAATT
CCAGTGGCGATGACCCTGGAAAAGAATATGCCGATCGGTTCGGGCTTAGGCTCCAGTGCC
TGTTCGGTGGTCGCGGCGCTGATGGCGATGAATGAACACTGCGGCAAGCCGCTTAATGAC
ACTCGTTTGCTGGCTTTGATGGGCGAGCTGGAAGGCCGTATCTCCGGCAGCATTCATTAC
GACAACGTGGCACCGTGTTTTCTCGGTGGTATGCAGTTGATGATCGAAGAAAACGACATC
ATCAGCCAGCAAGTGCCAGGGTTTGATGAGTGGCTGTGGGTGCTGGCGTATCCGGGGATT
AAAGTCTCGACGGCAGAAGCCAGGGCTATTTTACCGGCGCAGTATCGCCGCCAGGATTGC
ATTGCGCACGGGCGACATCTGGCAGGCTTCATTCACGCCTGCTATTCCCGTCAGCCTGAG
CTTGCCGCGAAGCTGATGAAAGATGTTATCGCTGAACCCTACCGTGAACGGTTACTGCCA
GGCTTCCGGCAGGCGCGGCAGGCGGTCGCGGAAATCGGCGCGGTAGCGAGCGGTATCTCC
GGCTCCGGCCCGACCTTGTTCGCTCTGTGTGACAAGCCGGAAACCGCCCAGCGCGTTGCC
GACTGGTTGGGTAAGAACTACCTGCAAAATCAGGAAGGTTTTGTTCATATTTGCCGGCTG
GATACGGCGGGCGCACGAGTACTGGAAAACTAA
Protein Properties
Pfam Domain Function:
Protein Residues:310
Protein Molecular Weight:33422
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Homocysteine S-methyltransferase
MSQNNPLRALLDKQDILLLDGAMATELEARGCNLADSLWSAKVLVENPELIREVHLDYYR
AGAQCAITASYQATPAGFAARGLDEAQSKALIGKSVELARKAREAYLAENPQAGTLLVAG
SVGPYGAYLADGSEYRGDYHCSVEAFQAFHRPRVEALLDAGADLLACETLPNFSEIEALA
ELLTAYPRARAWFSFTLRDSEHLSDGTPLRDVVALLAGYPQVVALGINCIALENTTAALQ
HLHGLTVLPLVVYPNSGEHYDAVSKTWHHHGEHCAQLADYLPQWQAAGARLIGGCCRTTP
ADIAALKARS
References
External Links:
ResourceLink
Uniprot ID:Q47690
Uniprot Name:MMUM_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674277
Ecogene ID:EG13343
Ecocyc:EG13343
ColiBase:b0261
Kegg Gene:b0261
EchoBASE ID:EB3127
CCDB:MMUM_ECOLI
BacMap:16128246
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Neuhierl, B., Thanbichler, M., Lottspeich, F., Bock, A. (1999). "A family of S-methylmethionine-dependent thiol/selenol methyltransferases. Role in selenium tolerance and evolutionary relation." J Biol Chem 274:5407-5414. Pubmed: 10026151
  • Thanbichler, M., Neuhierl, B., Bock, A. (1999). "S-methylmethionine metabolism in Escherichia coli." J Bacteriol 181:662-665. Pubmed: 9882684