Identification
Name:[Citrate [pro-3S]-lyase] ligase
Synonyms:
  • Acetate:SH-citrate lyase ligase
  • Citrate lyase synthetase
Gene Name:citC
Enzyme Class:
Biological Properties
General Function:Involved in [citrate (pro-3S)-lyase] ligase activity
Specific Function:Acetylation of prosthetic group (2-(5''-phosphoribosyl)- 3'-dephosphocoenzyme-A) of the gamma subunit of citrate lyase
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+Citrate (pro-3S)-lyase (thiol form)Thumb+Thumb+Citrate (pro-3S)-lyase (acetyl form)
Adenosine triphosphate + Acetic acid + Citrate (pro-3S)-lyase (thiol form) ↔ Adenosine monophosphate + Pyrophosphate + Citrate (pro-3S)-lyase (acetyl form)
ReactionCard
SMPDB Reactions:
[a holo citrate lyase acyl-carrier protein]+Thumb+ThumbThumb+Pyrophosphate+an acetyl-[holo citrate lyase acyl-carrier protein]
[a holo citrate lyase acyl-carrier protein] + Adenosine triphosphate + Acetic acidAdenosine monophosphate + Pyrophosphate + an acetyl-[holo citrate lyase acyl-carrier protein]
ReactionCard
Complex Reactions:
Thumb+Thumb+[citrate (pro-3S)-lyase](thiol form)Thumb+Thumb+[citrate (pro-3S)-lyase](acetyl form)
Adenosine triphosphate + Acetic acid + [citrate (pro-3S)-lyase](thiol form) → Adenosine monophosphate + Pyrophosphate + [citrate (pro-3S)-lyase](acetyl form)
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB214832-5-Phosphoribosyl-3-dephospho-CoAMetaboCard
ECMDB00042Acetic acidMetaboCard
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB04142PyrophosphateMetaboCard
GO Classification:
Function
acetyltransferase activity
acid-thiol ligase activity
acyltransferase activity
catalytic activity
ligase activity
ligase activity, forming carbon-sulfur bonds
N-acetyltransferase activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
[citrate (pro-3S)-lyase] ligase activity
Process
biosynthetic process
metabolic process
Gene Properties
Blattner:b0618
Gene OrientationCounterclockwise
Centisome Percentage:14.01
Left Sequence End650021
Right Sequence End651079
Gene Sequence:
>1059 bp
ATGTTCGGCAATGATATTTTCACCCGCGTAAAACGTTCAGAAAATAAAAAAATGGCGGAA
ATCGCCCAATTCCTGCATGAAAATGATTTGAGCGTTGACACCACAGTCGAAGTATTTATT
ACCGTAACCCGCGATGAAAAGCTTATCGCGTGCGGTGGAATTGCCGGAAATATTATTAAA
TGCGTTGCTATCAGTGAATCCGTCCGCGGTGAAGGACTGGCGCTGACATTAGCCACTGAA
TTGATAAACCTCGCCTATGAGCGGCACAGCACGCATCTGTTTATTTATACCAAAACCGAA
TACGAGGCGCTGTTCCGCCAGTGCGGTTTTTCCACGCTGACCAGCGTACCCGGCGTGATG
GTGCTGATGGAAAACAGCGCCACGCGACTGAAACGCTATGCCGAATCGCTGAAAAAATTT
CGTCATCCAGGGAACAAGATTGGCTGCATTGTGATGAACGCCAATCCCTTTACGAATGGT
CACCGTTATCTGATTCAACAGGCTGCGGCACAGTGCGACTGGTTGCATCTGTTTTTAGTC
AAAGAAGATTCTTCACGCTTCCCCTATGAAGACCGGCTGGATTTGGTGTTAAAAGGCACC
GCCGATATTCCACGCCTGACTGTGCATCGTGGCTCCGAATACATCATCTCCCGCGCTACG
TTCCCTTGCTACTTCATTAAAGAACAGAGCGTCATTAACCATTGTTACACCGAAATTGAT
CTGAAGATTTTCCGTCAGTACCTCGCTCCCGCGCTGGGTGTAACTCACCGCTTTGTCGGT
ACTGAACCCTTTTGTCGCGTTACCGCCCAGTACAACCAGGATATGCGCTACTGGCTGGAA
ACGCCGACTATCTCCGCACCGCCCATCGAACTGGTTGAAATTGAGCGGCTGCGTTACCAG
GAGATGCCGATATCCGCTTCCCGGGTACGTCAACTGCTGGCGAAAAACGATCTCACGGCT
ATCGCGCCGCTGGTCCCTGCAGTCACGCTGCATTATTTGCAGAACCTGCTTGAGCACTCC
CGCCAGGACGCGGCAGCTCGTCAAAAGACCCCCGCATGA
Protein Properties
Pfam Domain Function:
Protein Residues:352
Protein Molecular Weight:40077
Protein Theoretical pI:8
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>[Citrate [pro-3S]-lyase] ligase
MFGNDIFTRVKRSENKKMAEIAQFLHENDLSVDTTVEVFITVTRDEKLIACGGIAGNIIK
CVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKTEYEALFRQCGFSTLTSVPGVM
VLMENSATRLKRYAESLKKFRHPGNKIGCIVMNANPFTNGHRYLIQQAAAQCDWLHLFLV
KEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFPCYFIKEQSVINHCYTEID
LKIFRQYLAPALGVTHRFVGTEPFCRVTAQYNQDMRYWLETPTISAPPIELVEIERLRYQ
EMPISASRVRQLLAKNDLTAIAPLVPAVTLHYLQNLLEHSRQDAAARQKTPA
References
External Links:
ResourceLink
Uniprot ID:P77390
Uniprot Name:CITC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674725
Ecogene ID:EG13645
Ecocyc:EG13645
ColiBase:b0618
Kegg Gene:b0618
EchoBASE ID:EB3409
CCDB:CITC_ECOLI
BacMap:90111154
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232