Identification
Name:5'-nucleotidase yfbR
Synonyms:
  • 5'-deoxyribonucleotidase
  • Nucleoside 5'-monophosphate phosphohydrolase
Gene Name:yfbR
Enzyme Class:
Biological Properties
General Function:Involved in catalytic activity
Specific Function:Nucleotidase that shows strict specificity toward deoxyribonucleoside 5'-monophosphates and does not dephosphorylate 5'-ribonucleotides or ribonucleoside 3'-monophosphates. Might be involved in the regulation of all dNTP pools in E.coli
Cellular Location:Cytoplasm (Potential)
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
5'-Ribonucleotide+ThumbThumb+Thumb
5'-Ribonucleotide + WaterRibonucleoside + Phosphate
ReactionCard
Deoxynucleoside 5'-phosphate+ThumbDeoxynucleoside+Thumb
Deoxynucleoside 5'-phosphate + Water ↔ Deoxynucleoside + Phosphate
ReactionCard
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB010442'-Deoxyguanosine 5'-monophosphateMetaboCard
ECMDB012275-Thymidylic acidMetaboCard
ECMDB00050AdenosineMetaboCard
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB00089CytidineMetaboCard
ECMDB00095Cytidine monophosphateMetaboCard
ECMDB01202dCMPMetaboCard
ECMDB00101DeoxyadenosineMetaboCard
ECMDB00905Deoxyadenosine monophosphateMetaboCard
ECMDB00014DeoxycytidineMetaboCard
ECMDB00085DeoxyguanosineMetaboCard
ECMDB00071DeoxyinosineMetaboCard
ECMDB00012DeoxyuridineMetaboCard
ECMDB06555DIMPMetaboCard
ECMDB01409dUMPMetaboCard
ECMDB00133GuanosineMetaboCard
ECMDB01397Guanosine monophosphateMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB00195InosineMetaboCard
ECMDB04085Inosinic acidMetaboCard
ECMDB00855Nicotinamide ribosideMetaboCard
ECMDB00229Nicotinamide ribotideMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00273ThymidineMetaboCard
ECMDB00296UridineMetaboCard
ECMDB00288Uridine 5'-monophosphateMetaboCard
ECMDB00494WaterMetaboCard
ECMDB00299XanthosineMetaboCard
ECMDB01554Xanthylic acidMetaboCard
GO Classification:
Function
catalytic activity
Gene Properties
Blattner:b2291
Gene OrientationClockwise
Centisome Percentage:51.88
Left Sequence End2406884
Right Sequence End2407483
Gene Sequence:
>600 bp
ATGACCACGCTGACAGCACAACAGATTGCCTGTGTTTACGCCTGGCTAGCGCAGTTGTTC
TCCCGTGAGCTGGACGATGAACAACTGACGCAAATCGCCAGTGCGCAGATGGCTGAATGG
TTTTCGTTGCTGAAAAGCGAACCGCCGCTCACTGCGGCGGTGAACGAGCTGGAAAACCGT
ATTGCCACGCTGACAGTACGTGACGATGCCCGTCTGGAACTGGCCGCGGACTTTTGCGGC
CTGTTTCTGATGACCGACAAACAAGCGGCGCTGCCGTATGCATCGGCCTACAAACAGGAC
GAGCAAGAGATTAAACGCTTGTTAGTTGAGGCAGGGATGGAAACCAGCGGCAATTTCAAC
GAACCGGCAGATCATCTGGCGATCTATCTCGAATTGCTCAGCCATCTGCATTTTTCGCTG
GGAGAGGGGACCGTTCCTGCGCGAAGAATCGACAGTTTGCGGCAAAAAACACTGACGGCG
CTGTGGCAATGGTTACCAGAGTTTGTTGCGCGTTGTCGTCAGTATGACAGCTTTGGTTTT
TACGCGGCACTAAGCCAGTTATTGCTGGTGTTAGTGGAGTGCGACCACCAAAACAGATAA
Protein Properties
Pfam Domain Function:
Protein Residues:199
Protein Molecular Weight:22708
Protein Theoretical pI:6
PDB File:1WPH
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>5'-nucleotidase yfbR
MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
IFVPSFHLSLDEISQDSPL
References
External Links:
ResourceLink
Uniprot ID:P76491
Uniprot Name:YFBR_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651490
PDB ID:1WPH
Ecogene ID:EG14102
Ecocyc:EG14102
ColiBase:b2291
Kegg Gene:b2291
EchoBASE ID:EB3855
CCDB:YFBR_ECOLI
BacMap:16130226
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Proudfoot, M., Kuznetsova, E., Brown, G., Rao, N. N., Kitagawa, M., Mori, H., Savchenko, A., Yakunin, A. F. (2004). "General enzymatic screens identify three new nucleotidases in Escherichia coli. Biochemical characterization of SurE, YfbR, and YjjG." J Biol Chem 279:54687-54694. Pubmed: 15489502