Identification
Name:Phenylacetic acid degradation protein paaC
Synonyms:Not Available
Gene Name:paaC
Enzyme Class:
Biological Properties
General Function:Involved in oxidoreductase activity
Specific Function:May be part of a multicomponent oxygenase involved in phenylacetyl-CoA hydroxylation
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
  • Microbial metabolism in diverse environments ec01120
  • Phenylalanine metabolism ec00360
KEGG Reactions:
Thumb+Thumb+Thumb+Thumb2-(1,2-Epoxy-1,2-dihydrophenyl)acetyl-CoA+Thumb+Thumb+Thumb
SMPDB Reactions:
Thumb+Thumb+Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB231592-(1,2-Epoxy-1,2-dihydrophenyl)acetyl-CoAMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB04124OxygenMetaboCard
ECMDB06503Phenylacetyl-CoAMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
catalytic activity
cation binding
ion binding
metal ion binding
oxidoreductase activity
transition metal ion binding
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b1390
Gene OrientationClockwise
Centisome Percentage:31.32
Left Sequence End1453188
Right Sequence End1453934
Gene Sequence:
>747 bp
ATGGATTTCAGCGGTAAAAATGTCTGGGTAACCGGCGCAGGTAAAGGTATCGGCTACGCC
ACGGCGCTGGCGTTTGTTGAGGCGGGAGCGAAAGTTACAGGTTTTGATCAAGCGTTCACT
CAGGAGCAATATCCCTTTGCGACCGAAGTGATGGATGTTGCCGACGCTGCGCAGGTCGCG
CAAGTGTGTCAGCGACTGTTAGCTGAAACGGAGCGACTGGACGCGCTGGTCAATGCGGCG
GGAATTTTACGCATGGGCGCGACCGATCAGCTCAGTAAAGAGGACTGGCAGCAGACTTTT
GCGGTTAACGTCGGCGGTGCGTTTAACCTGTTCCAGCAAACCATGAACCAGTTTCGCCGT
CAGCGGGGCGGGGCGATTGTCACTGTGGCGTCCGACGCCGCGCACACGCCGCGTATTGGC
ATGAGTGCTTATGGCGCATCGAAAGCGGCGCTGAAAAGCCTGGCGTTGAGCGTCGGGCTG
GAACTGGCGGGTAGCGGCGTGCGCTGTAATGTGGTTTCGCCTGGCTCCACCGACACCGAT
ATGCAACGCACGCTGTGGGTGAGCGATGACGCCGAAGAACAGCGTATTCGCGGCTTTGGC
GAGCAGTTTAAACTCGGCATTCCGCTGGGGAAAATCGCCCGTCCACAAGAGATCGCCAAC
ACGATTTTGTTCCTCGCCTCTGACCTCGCCAGCCATATTACCCTACAGGATATTGTGGTC
GATGGCGGCTCAACGCTGGGGGCATAA
Protein Properties
Pfam Domain Function:
Protein Residues:248
Protein Molecular Weight:27877
Protein Theoretical pI:5
PDB File:1OTK
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Phenylacetic acid degradation protein paaC
MNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELA
GEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLA
AISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALS
EEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQ
RVLPGQQW
References
External Links:
ResourceLink
Uniprot ID:P76079
Uniprot Name:PAAC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674717
PDB ID:1OTK
Ecogene ID:EG13737
Ecocyc:EG13737
ColiBase:b1390
Kegg Gene:b1390
EchoBASE ID:EB3500
CCDB:PAAC_ECOLI
BacMap:16129351
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Ferrandez, A., Garcia, J. L., Diaz, E. (2000). "Transcriptional regulation of the divergent paa catabolic operons for phenylacetic acid degradation in Escherichia coli." J Biol Chem 275:12214-12222. Pubmed: 10766858
  • Ferrandez, A., Minambres, B., Garcia, B., Olivera, E. R., Luengo, J. M., Garcia, J. L., Diaz, E. (1998). "Catabolism of phenylacetic acid in Escherichia coli. Characterization of a new aerobic hybrid pathway." J Biol Chem 273:25974-25986. Pubmed: 9748275
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553