Identification
Name:N-acetyl-D-glucosamine kinase
Synonyms:
  • GlcNAc kinase
Gene Name:nagK
Enzyme Class:
Biological Properties
General Function:Involved in N-acetylglucosamine kinase activity
Specific Function:Catalyzes the phosphorylation of N-acetyl-D-glucosamine (GlcNAc) derived from cell-wall degradation, yielding GlcNAc-6-P. Has also low level glucokinase activity in vitro
Cellular Location:Not Available
SMPDB Pathways:
  • Amino sugar and nucleotide sugar metabolism I PW000886
  • Amino sugar and nucleotide sugar metabolism II PW000887
  • Amino sugar and nucleotide sugar metabolism III PW000895
KEGG Pathways:
  • Amino sugar and nucleotide sugar metabolism ec00520
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
N-Acetyl-D-glucosamine+Thumb+ThumbN-Acetyl-D-Glucosamine 6-Phosphate+Adenosine diphosphate+Thumb+Thumb+Thumb
N-Acetyl-D-glucosamine + Adenosine triphosphate + N-Acetylglucosamine → N-Acetyl-D-Glucosamine 6-Phosphate + Adenosine diphosphate + Hydrogen ion + N-Acetyl-D-Glucosamine 6-Phosphate + ADP
ReactionCard
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00215N-Acetyl-D-glucosamineMetaboCard
ECMDB01062N-Acetyl-D-Glucosamine 6-PhosphateMetaboCard
ECMDB21561N-AcetylglucosamineMetaboCard
GO Classification:Not Available
Gene Properties
Blattner:b1119
Gene OrientationClockwise
Centisome Percentage:25.39
Left Sequence End1177816
Right Sequence End1178727
Gene Sequence:
>912 bp
ATGCGACTATTTAACTGGCGACGTCAGGCGGTGTTAAACGCCATGCCACTGGTCAAACCT
GACCAGGTACGTACACCGTGGCATGAATTCTGGCGACGATTTCGCCGTCAGCATATGGCG
ATGACCGCCGCATTATTCGTTATTTTATTGATTGTGGTGGCCATTTTTGCACGCTGGATC
GCTCCCTATGACGCCGAAAATTATTTTGATTATGACAATCTGAATAACGGACCTTCTTTG
CAGCACTGGTTTGGCGTCGATTCACTGGGGCGTGACATTTTCAGCCGTGTCCTGGTTGGT
GCGCAAATCTCGCTGGCGGCGGGCGTGTTTGCCGTGTTTATCGGTGCGGCGATCGGGACG
TTGCTGGGCTTGCTCGCTGGATATTATGAAGGCTGGTGGGATCGGCTGATCATGCGCATT
TGCGATGTGCTGTTTGCCTTCCCGGGTATTTTACTGGCGATCGCTGTTGTTGCGGTGTTG
GGAAGCGGCATTGCTAACGTGATTATTGCAGTCGCCATTTTTTCCATCCCCGCGTTTGCC
CGCCTGGTGCGCGGCAACACGCTGGTGTTGAAACAGCAAACCTTTATTGAGTCAGCACGC
AGTATTGGTGCCAGCGATATGACCGTTTTGTTGCGTCATATCCTGCCTGGGACCGTCTCT
TCTATCGTGGTGTTTTTCACCATGCGCATTGGTACCTCGATTATCTCTGCCGCCAGCCTC
TCATTTCTCGGCCTCGGTGCGCAGCCGCCGACACCAGAGTGGGGAGCAATGCTCAATGAG
GCTCGAGCGGATATGGTTATCGCGCCGCATGTCGCTGTTTTTCCGGCCCTGGCTATTTTT
CTGACCGTACTGGCGTTCAATTTGTTGGGCGATGGTTTACGCGATGCGCTGGATCCGAAA
ATTAAAGGATAG
Protein Properties
Pfam Domain Function:
Protein Residues:303
Protein Molecular Weight:33042
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>N-acetyl-D-glucosamine kinase
MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCG
QHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNI
LTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLH
LTD
References
External Links:
ResourceLink
Uniprot ID:P75959
Uniprot Name:NAGK_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062409
Ecogene ID:EG13442
Ecocyc:EG13442
ColiBase:b1119
Kegg Gene:b1119
EchoBASE ID:EB3216
CCDB:NAGK_ECOLI
BacMap:16129082
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Miller, B. G., Raines, R. T. (2004). "Identifying latent enzyme activities: substrate ambiguity within modern bacterial sugar kinases." Biochemistry 43:6387-6392. Pubmed: 15157072
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232
  • Uehara, T., Park, J. T. (2004). "The N-acetyl-D-glucosamine kinase of Escherichia coli and its role in murein recycling." J Bacteriol 186:7273-7279. Pubmed: 15489439