Canmetcon
Identification
Name:Carbamate kinase
Synonyms:Not Available
Gene Name:arcC
Enzyme Class:
Biological Properties
General Function:Involved in cellular amino acid biosynthetic process
Specific Function:ATP + NH(3) + CO(2) = ADP + carbamoyl phosphate
Cellular Location:Cytoplasm (Potential)
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
Thumb+ThumbThumb
Thumb+Thumb+2 ThumbThumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb+2 Thumb
Thumb+Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB03551Carbamic acidMetaboCard
ECMDB01096CarbamoylphosphateMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
carbamate kinase activity
catalytic activity
kinase activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
arginine metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid biosynthetic process
cellular amino acid metabolic process
cellular metabolic process
glutamine family amino acid metabolic process
metabolic process
Gene Properties
Blattner:b0521
Gene OrientationClockwise
Centisome Percentage:11.85
Left Sequence End549662
Right Sequence End550555
Gene Sequence:
>894 bp
ATGAAAACACTGGTTGTGGCTCTTGGGGGCAACGCCTTACTCCAGCGCGGTGAGGCGCTG
ACGGCAGAAAATCAATATCGCAATATCGCCAGTGCTGTACCCGCGCTGGCACGCCTGGCC
CGTTCTTATCGGTTGGCGATTGTTCACGGCAACGGGCCGCAGGTGGGGCTGCTGGCATTG
CAGAATCTGGCGTGGAAAGAGGTAGAACCGTATCCGCTGGATGTGCTGGTTGCGGAAAGC
CAGGGGATGATTGGCTATATGCTGGCGCAGAGTTTGAGCGCACAGCCGCAGATGCCGCCC
GTGACGACGGTGCTGACGCGCATTGAGGTTTCGCCTGATGATCCGGCGTTTTTGCAGCCA
GAGAAATTTATTGGTCCGGTTTATCAGCCAGAAGAACAAGAGGCACTGGAAGCGGCTTAC
GGCTGGCAGATGAAACGTGATGGTAAATATTTGCGCCGGGTGGTGGCGTCTCCGCAACCG
CGTAAAATTCTCGACAGCGAAGCCATCGAGTTGTTGCTCAAAGAGGGGCATGTGGTGATT
TGCAGTGGCGGCGGCGGTGTGCCTGTGACGGATGACGGAGCAGGGAGTGAAGCAGTGATT
GATAAAGATCTCGCCGCTGCGTTGCTCGCCGAGCAGATTAATGCAGATGGACTGGTGATC
CTCACCGATGCTGATGCGGTATATGAAAACTGGGGAACGCCGCAGCAACGTGCCATTCGC
CATGCCACACCGGATGAGTTAGCGCCATTTGCCAAAGCCGATGGTTCGATGGGGCCGAAT
GTAACGGCGGTGAGTGGTTATGTCAGAAGCCGTGGTAAACCCGCGTGGATTGGGGCGTTA
TCGCGAATTGAAGAGACGCTGGCGGGCGAAGCGGGGACCTGTATTTCGCTGTAG
Protein Properties
Pfam Domain Function:
Protein Residues:297
Protein Molecular Weight:31644
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Carbamate kinase
MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRLAIVHGNGPQVGLLAL
QNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTVLTRIEVSPDDPAFLQP
EKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKILDSEAIELLLKEGHVVI
CSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILTDADAVYENWGTPQQRAIR
HATPDELAPFAKADGSMGPNVTAVSGYVRSRGKPAWIGALSRIEETLAGEAGTCISL
References
External Links:
ResourceLink
Uniprot ID:P37306
Uniprot Name:ARCC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674658
Ecogene ID:EG12384
Ecocyc:EG12384
ColiBase:b0521
Kegg Gene:b0521
EchoBASE ID:EB2285
CCDB:ARCC_ECOLI
BacMap:16128505
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Borodovsky, M., Koonin, E. V., Rudd, K. E. (1994). "New genes in old sequence: a strategy for finding genes in the bacterial genome." Trends Biochem Sci 19:309-313. Pubmed: 7940673
  • Borodovsky, M., Rudd, K. E., Koonin, E. V. (1994). "Intrinsic and extrinsic approaches for detecting genes in a bacterial genome." Nucleic Acids Res 22:4756-4767. Pubmed: 7984428
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Robison, K., Gilbert, W., Church, G. M. (1994). "Large scale bacterial gene discovery by similarity search." Nat Genet 7:205-214. Pubmed: 7920643
  • Tiedeman, A. A., Keyhani, J., Kamholz, J., Daum, H. A. 3rd, Gots, J. S., Smith, J. M. (1989). "Nucleotide sequence analysis of the purEK operon encoding 5'-phosphoribosyl-5-aminoimidazole carboxylase of Escherichia coli K-12." J Bacteriol 171:205-212. Pubmed: 2464576
  • Watanabe, W., Sampei, G., Aiba, A., Mizobuchi, K. (1989). "Identification and sequence analysis of Escherichia coli purE and purK genes encoding 5'-phosphoribosyl-5-amino-4-imidazole carboxylase for de novo purine biosynthesis." J Bacteriol 171:198-204. Pubmed: 2644189