Identification
Name:Adenine deaminase
Synonyms:
  • Adenase
  • Adenine aminase
Gene Name:ade
Enzyme Class:
Biological Properties
General Function:Involved in adenine deaminase activity
Specific Function:Adenine + H(2)O = hypoxanthine + NH(3)
Cellular Location:Cytoplasmic
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
2 Thumb2 Thumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00034AdenineMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21232Hydrogen peroxideMetaboCard
ECMDB00157HypoxanthineMetaboCard
ECMDB04124OxygenMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
adenine deaminase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
Process
adenine catabolic process
cellular aromatic compound metabolic process
cellular metabolic process
metabolic process
nucleobase metabolic process
purine base catabolic process
purine base metabolic process
Gene Properties
Blattner:b3665
Gene OrientationClockwise
Centisome Percentage:82.81
Left Sequence End3841987
Right Sequence End3843753
Gene Sequence:
>1767 bp
ATGAAAGCAGCGGCGAAAACGCAGAAACCAAAACGTCAGGAAGAACATGCCAACTTTATC
AGTTGGCGTTTTGCGTTGTTATGCGGCTGTATTCTCCTGGCGCTGGCTTTTCTGCTCGGA
CGCGTAGCGTGGTTACAAGTTATCTCCCCGGATATGCTGGTGAAAGAGGGCGACATGCGT
TCTCTTCGCGTTCAGCAAGTTTCCACCTCCCGCGGCATGATTACTGACCGTTCTGGTCGC
CCGTTAGCGGTGAGCGTGCCGGTAAAAGCGATTTGGGCTGACCCGAAAGAAGTGCATGAC
GCTGGCGGTATCAGCGTCGGTGACCGCTGGAAGGCGCTGGCTAACGCGCTCAATATTCCG
CTGGATCAGCTTTCAGCCCGCATTAACGCCAACCCGAAAGGGCGCTTTATTTATCTGGCG
CGTCAGGTGAACCCTGACATGGCGGACTACATCAAAAAACTGAAACTGCCGGGGATTCAT
CTGCGTGAAGAGTCTCGCCGTTACTATCCGTCCGGCGAAGTGACTGCTCACCTCATCGGC
TTTACTAACGTCGATAGTCAAGGGATTGAGGGCGTTGAGAAGAGTTTCGATAAATGGCTT
ACCGGGCAGCCGGGTGAGCGCATTGTGCGTAAAGACCGCTATGGTCGCGTAATTGAAGAT
ATTTCTTCTACTGACAGCCAGGCAGCGCACAACCTGGCGCTGAGTATTGATGAACGCCTG
CAGGCGCTGGTTTATCGCGAACTGAACAACGCGGTGGCCTTTAACAAGGCTGAATCTGGT
AGCGCCGTGCTGGTGGATGTCAACACCGGTGAAGTGCTGGCGATGGCTAACAGCCCGTCA
TACAACCCTAACAATCTGAGCGGCACGCCGAAAGAGGCGATGCGTAACCGTACCATCACC
GACGTGTTTGAACCGGGCTCAACGGTTAAACCGATGGTGGTAATGACCGCGTTGCAACGT
GGCGTGGTGCGGGAAAACTCGGTACTCAATACCATTCCTTATCGAATTAACGGCCACGAA
ATCAAAGACGTGGCACGCTACAGCGAATTAACCCTGACCGGGGTATTACAGAAGTCGAGT
AACGTCGGTGTTTCCAAGCTGGCGTTAGCGATGCCGTCCTCAGCGTTAGTAGATACTTAC
TCACGTTTTGGACTGGGAAAAGCGACCAATTTGGGGTTGGTCGGAGAACGCAGTGGCTTA
TATCCTCAAAAACAACGGTGGTCTGACATAGAGAGGGCCACCTTCTCTTTCGGCTACGGG
CTAATGGTAACACCATTACAGTTAGCGCGAGTCTACGCAACTATCGGCAGCTACGGCATT
TATCGCCCACTGTCGATTACCAAAGTTGACCCCCCGGTTCCCGGTGAACGTGTCTTCCCG
GAATCCATTGTCCGCACTGTGGTGCATATGATGGAAAGCGTGGCGCTACCAGGCGGCGGC
GGCGTGAAGGCGGCGATTAAAGGCTATCGTATCGCCATTAAAACCGGTACCGCGAAAAAG
GTCGGGCCGGACGGTCGCTACATCAATAAATATATTGCTTATACCGCAGGCGTTGCGCCT
GCGAGTCAGCCGCGCTTCGCGCTGGTTGTTGTTATCAACGATCCGCAGGCGGGTAAATAC
TACGGCGGCGCCGTTTCCGCGCCGGTCTTTGGTGCCATCATGGGCGGCGTATTGCGTACC
ATGAACATCGAGCCGGATGCGCTGACAACGGGCGATAAAAATGAATTTGTGATTAATCAA
GGCGAGGGGACAGGTGGCAGATCGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:588
Protein Molecular Weight:63739
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Adenine deaminase
MNNSINHKFHHISRAEYQELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIA
GVGAEYTDAPALQRIDARGATAVPGFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPH
EIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVPALEGCDVNGASFTLEQMLAWRDHPQV
TGLAEMMDYPGVISGQNALLDKLDAFRHLTLDGHCPGLGGKELNAYITAGIENCHESYQL
EEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAHEGHIDAL
IRRLIEQHNVPLHVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVK
GEPIDAQTLQAEESARLAQSAPPYGNTIARQPVSASDFALQFTPGKRYRVIDVIHNELIT
HSHSSVYSENGFDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVV
IGRSAEEMALAVNQVIQDGGGLCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAA
ARECGPLPDEPFIQMAFLSLPVIPALKLTSQGLFDGEKFAFTTLEVTE
References
External Links:
ResourceLink
Uniprot ID:P31441
Uniprot Name:ADEC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21321965
Ecogene ID:EG11692
Ecocyc:EG11692
ColiBase:b3665
Kegg Gene:b3665
EchoBASE ID:EB1643
CCDB:ADEC_ECOLI
BacMap:16131535
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Matsui, H., Shimaoka, M., Kawasaki, H., Takenaka, Y., Kurahashi, O. (2001). "Adenine deaminase activity of the yicP gene product of Escherichia coli." Biosci Biotechnol Biochem 65:1112-1118. Pubmed: 11440125
  • Petersen, C., Moller, L. B., Valentin-Hansen, P. (2002). "The cryptic adenine deaminase gene of Escherichia coli. Silencing by the nucleoid-associated DNA-binding protein, H-NS, and activation by insertion elements." J Biol Chem 277:31373-31380. Pubmed: 12077137