Identification
Name:NAD(P)H-flavin reductase
Synonyms:
  • Aquacobalamin reductase
  • FMN reductase
  • Ferrisiderophore reductase C
  • NAD(P)H:flavin oxidoreductase
Gene Name:fre
Enzyme Class:
Biological Properties
General Function:Involved in oxidoreductase activity
Specific Function:Catalyzes the reduction of soluble flavins by reduced pyridine nucleotides. Seems to reduces the complexed Fe(3+) iron of siderophores to Fe(2+), thus releasing it from the chelator
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+2 Thumb+2 Thumb+ThumbThumb+2 Thumb
Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
Thumb+Thumb+2 ThumbRiboflavin reduced+Thumb
Riboflavin + NADPH + 2 Hydrogen ion → Riboflavin reduced + NADP
ReactionCard
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
NAD(P)++ThumbNAD(P)H+Thumb+Thumb
Thumb+NAD(P)+ ? Thumb+NAD(P)H+Thumb
Complex Reactions:
Thumb+2 ThumbThumb+2 Thumb+2 Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+NAD(P)(+)Thumb+NAD(P)H
Reduced riboflavin + NAD(P)(+) → Riboflavin + NAD(P)H
ReactionCard
2 Thumb+Thumb2 Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB03458AquacobalaminMetaboCard
ECMDB06316Cob(II)alaminMetaboCard
ECMDB01248FADMetaboCard
ECMDB01197FADH2MetaboCard
ECMDB21395Fe3+MetaboCard
ECMDB01520Flavin MononucleotideMetaboCard
ECMDB01142FMNHMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00692IronMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB21279Reduced riboflavinMetaboCard
ECMDB00244RiboflavinMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
oxidoreductase activity
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b3844
Gene OrientationClockwise
Centisome Percentage:86.74
Left Sequence End4024550
Right Sequence End4025251
Gene Sequence:
>702 bp
ATGAAAACTTGCATAACAAAGGGAATTGTGACCGTAAGTTTAACGGCAATATTACTCAGC
TGCTCATCCGCATGGGCGGCAGGTAAAGGCGGGATTGGACTTGCAGCAACACGTCTTGTT
TATTCAGAAGGTGAAGAGCAAATTTCACTGGGTGTACGTAACACCAGTCCGGATGTTCCT
TATCTTATTCAGTCATGGGTGATGACCCCAGATAATAAAAAATCAGCAGACTTTATTATT
ACACCACCGCTATTTGTGCTGAATCCGGCAAATGAGAATCTGTTACGCATTATGTACATT
GGAGCGCCGTTGGCGAAAGACAGAGAAACCCTTTTCTTCACTAGCGTACGGGCAGTCCCT
TCAACAACGAAGCGGAAAGAGGGAAATACCCTGAAGATTGCCACACAAAGCGTCATCAAA
CTTTTCTGGCGACCAAAAGGTTTAGCGTATCCCTTAGGCGAGGCTCCGGCGAAACTGCGT
TGCACTTCGTCAGCTGACATGGTTACGGTCAGTAACCCAACACCTTATTTCATTACCCTG
ACAGACCTGAAAATAGGTGGAAAAGTAGTTAAAAATCAAATGATTTCCCCCTTTGATAAA
TACCAATTTTCTCTGCCAAAGGGGGCCAAAAATAGCAGCGTAACGTATCGAACCATCAAT
GACTACGGGGCGGAAACGCCGCAACTCAACTGTAAATCGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:233
Protein Molecular Weight:26242
Protein Theoretical pI:5
PDB File:1QFJ
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>NAD(P)H-flavin reductase
MTTLSCKVTSVEAITDTVYRVRIVPDAAFSFRAGQYLMVVMDERDKRPFSMASTPDEKGF
IELHIGASEINLYAKAVMDRILKDHQIVVDIPHGEAWLRDDEERPMILIAGGTGFSYARS
ILLTALARNPNRDITIYWGGREEQHLYDLCELEALSLKHPGLQVVPVVEQPEAGWRGRTG
TVLTAVLQDHGTLAEHDIYIAGRFEMAKIARDLFCSERNAREDRLFGDAFAFI
References
External Links:
ResourceLink
Uniprot ID:P0AEN1
Uniprot Name:FRE_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062507
PDB ID:1QFJ
Ecogene ID:EG10334
Ecocyc:EG10334
ColiBase:b3844
Kegg Gene:b3844
EchoBASE ID:EB0330
CCDB:FRE_ECOLI
BacMap:16131690
General Reference:
  • Andrews, S. C., Shipley, D., Keen, J. N., Findlay, J. B., Harrison, P. M., Guest, J. R. (1992). "The haemoglobin-like protein (HMP) of Escherichia coli has ferrisiderophore reductase activity and its C-terminal domain shares homology with ferredoxin NADP+ reductases." FEBS Lett 302:247-252. Pubmed: 1601132
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daniels, D. L., Plunkett, G. 3rd, Burland, V., Blattner, F. R. (1992). "Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes." Science 257:771-778. Pubmed: 1379743
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Ingelman, M., Ramaswamy, S., Niviere, V., Fontecave, M., Eklund, H. (1999). "Crystal structure of NAD(P)H:flavin oxidoreductase from Escherichia coli." Biochemistry 38:7040-7049. Pubmed: 10353815
  • Spyrou, G., Haggard-Ljungquist, E., Krook, M., Jornvall, H., Nilsson, E., Reichard, P. (1991). "Characterization of the flavin reductase gene (fre) of Escherichia coli and construction of a plasmid for overproduction of the enzyme." J Bacteriol 173:3673-3679. Pubmed: 2050627