Identification
Name:Arginine ABC transporter permease protein ArtM
Synonyms:Not Available
Gene Name:artM
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transporter activity
Specific Function:Part of the ABC transporter complex ArtPIQMJ involved in arginine transport. Probably responsible for the translocation of the substrate across the membrane
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
KEGG Pathways:Not Available
SMPDB Reactions:
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Adenosine diphosphate+1.0Thumb+1.0Thumb+1.0Thumb
1.0L-Arginine + 1.0Adenosine triphosphate + 1.0Water → 1.0L-Arginine + 1.0Adenosine diphosphate + 1.0Phosphate + 1.0Hydrogen ion + 1.0ADP
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00517L-ArginineMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane
membrane part
Function
transporter activity
Process
establishment of localization
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>669 bp
ATGCCCGTCAAGGATTTGACGGGCATTACTGCAAAGGACGCGCAAATGTTATCTGTAGTT
AAACCTCTTCAGGAATTTGGTAAGCTCGATAAATGTTTGTCCAGATACGGTACGCGCTTC
GAGTTTAATAATGAAAAGCAAGTTATATTTTCCAGTGATGTCAATAACGAAGATACTTTC
GTTATTTTAGAGGGAGTTATCTCTCTGCGTAGAGAAGAAAACGTACTTATCGGTATTACC
CAGGCTCCTTATATTATGGGGCTGGCTGATGGTTTAATGAAAAACGATATACCATACAAA
TTAATATCAGAAGGAAATTGTACGGGATATCATCTACCAGCCAAACAAACCATTACGCTT
ATTGAACAAAATCAACTCTGGCGAGACGCTTTTTACTGGTTAGCCTGGCAAAATAGAATT
CTGGAATTACGCGACGTGCAGCTCATTGGGCATAATTCCTACGAACAAATCCGCGCAACA
TTATTATCAATGATTGACTGGAATGAAGAATTGCGATCACGTATTGGTGTGATGAATTAT
ATCCATCAACGTACACGCATATCGCGTTCTGTCGTCGCAGAAGTTCTCGCTGCTTTGCGT
AAAGGCGGCTATATCGAAATGAATAAAGGCAAACTGGTCGCTATCAACCGTTTGCCTTCA
GAGTATTAA
Protein Properties
Pfam Domain Function:
Protein Residues:222
Protein Molecular Weight:24914
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • 16-36
  • 50-70
  • 80-100
  • 155-175
  • 187-207
Protein Sequence:
>Arginine ABC transporter permease protein ArtM
MFEYLPELMKGLHTSLTLTVASLIVALILALIFTIILTLKTPVLVWLVRGYITLFTGTPL
LVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEG
QWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLL
YGRTYDVMVFGAAGIIYLVVNGLLTLMMRLIERKALAFERRN
References
External Links:
ResourceLink
Uniprot ID:P0AE32
Uniprot Name:ARTM_ECO57
GenBank Gene ID:AE005174
Genebank Protein ID:12513212
EchoBASE ID:EB1584
CCDB:ARTM_ECO57
General Reference:
  • Hayashi, T., Makino, K., Ohnishi, M., Kurokawa, K., Ishii, K., Yokoyama, K., Han, C. G., Ohtsubo, E., Nakayama, K., Murata, T., Tanaka, M., Tobe, T., Iida, T., Takami, H., Honda, T., Sasakawa, C., Ogasawara, N., Yasunaga, T., Kuhara, S., Shiba, T., Hattori, M., Shinagawa, H. (2001). "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12." DNA Res 8:11-22. Pubmed: 11258796
  • Perna, N. T., Plunkett, G. 3rd, Burland, V., Mau, B., Glasner, J. D., Rose, D. J., Mayhew, G. F., Evans, P. S., Gregor, J., Kirkpatrick, H. A., Posfai, G., Hackett, J., Klink, S., Boutin, A., Shao, Y., Miller, L., Grotbeck, E. J., Davis, N. W., Lim, A., Dimalanta, E. T., Potamousis, K. D., Apodaca, J., Anantharaman, T. S., Lin, J., Yen, G., Schwartz, D. C., Welch, R. A., Blattner, F. R. (2001). "Genome sequence of enterohaemorrhagic Escherichia coli O157:H7." Nature 409:529-533. Pubmed: 11206551