Identification
Name:3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit
Synonyms:
  • Digoxigenin ferredoxin subunit
Gene Name:hcaC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in oxidoreductase activity
Specific Function:Part of the multicomponent 3-phenylpropionate dioxygenase, that converts 3-phenylpropionic acid (PP) and cinnamic acid (CI) into 3-phenylpropionate-dihydrodiol (PP- dihydrodiol) and cinnamic acid-dihydrodiol (CI-dihydrodiol), respectively. This protein seems to be a 2Fe-2S ferredoxin
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+Thumb+ThumbThumb+Thumb
4-Chlorobiphenyl+Thumb+Thumb+Thumbcis-2,3-Dihydro-2,3-dihydroxy-4'-chlorobiphenyl+Thumb
4-Chlorobiphenyl + Oxygen + NADH + Hydrogen ion ↔ cis-2,3-Dihydro-2,3-dihydroxy-4'-chlorobiphenyl + NAD
ReactionCard
4-Chlorobiphenyl+Thumb+Thumb+Thumbcis-2,3-Dihydro-2,3-dihydroxy-4'-chlorobiphenyl+Thumb
4-Chlorobiphenyl + Oxygen + NADPH + Hydrogen ion ↔ cis-2,3-Dihydro-2,3-dihydroxy-4'-chlorobiphenyl + NADP
ReactionCard
Biphenyl+Thumb+Thumb+Thumbcis-2,3-Dihydro-2,3-dihydroxybiphenyl+Thumb
Biphenyl + Oxygen + NADH + Hydrogen ion ↔ cis-2,3-Dihydro-2,3-dihydroxybiphenyl + NAD
ReactionCard
Biphenyl+Thumb+Thumb+Thumbcis-2,3-Dihydro-2,3-dihydroxybiphenyl+Thumb
Biphenyl + Oxygen + NADPH + Hydrogen ion ↔ cis-2,3-Dihydro-2,3-dihydroxybiphenyl + NADP
ReactionCard
Thumb+Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+Thumb+Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB21422Cinnamic acidMetaboCard
ECMDB20129cis-3-(3-Carboxyethenyl)-3,5-cyclohexadiene-1,2-diolMetaboCard
ECMDB21320Cis-3-(3-carboxyethyl)-3,5-cyclohexadiene-1,2-diolMetaboCard
ECMDB20130cis-3-(Carboxy-ethyl)-3,5-cyclo-hexadiene-1,2-diolMetaboCard
ECMDB00764Hydrocinnamic acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB04124OxygenMetaboCard
ECMDB00930trans-Cinnamic acidMetaboCard
GO Classification:
Function
2 iron, 2 sulfur cluster binding
binding
catalytic activity
iron-sulfur cluster binding
metal cluster binding
oxidoreductase activity
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b2540
Gene OrientationClockwise
Centisome Percentage:57.52
Left Sequence End2668930
Right Sequence End2669250
Gene Sequence:
>321 bp
ATGAAAATAACATTACTGGTTACCTTGCTTTTCGGTCTGGTTTTTTTAACCACCGTCGGC
GCTGCCGAGAGAACTTTAACCCCACAACAACAGCGTATGACCTCCTGTAATCAGCAGGCG
ACGGCGCAGGCGTTGAAAGGGGATGCTCGTAAGACCTACATGAGTGATTGCCTGAAGAAC
AGCAAGTCTGCGCCTGGCGAAAAAAGTTTGACGCCACAGCAGCAAAAGATGCGCGAATGC
AATAATCAAGCAACACAACAATCTCTGAAAGGTGATGATCGTAATAAGTTTATGAGTGCC
TGCCTCAAGAAAGCCGCCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:106
Protein Molecular Weight:11329
Protein Theoretical pI:4
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit
MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATV
ECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP
References
External Links:
ResourceLink
Uniprot ID:P0ABW0
Uniprot Name:HCAC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674525
Ecogene ID:EG13458
Ecocyc:EG13458
ColiBase:b2540
Kegg Gene:b2540
EchoBASE ID:EB3231
CCDB:HCAC_ECOLI
BacMap:16130465
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Diaz, E., Ferrandez, A., Garcia, J. L. (1998). "Characterization of the hca cluster encoding the dioxygenolytic pathway for initial catabolism of 3-phenylpropionic acid in Escherichia coli K-12." J Bacteriol 180:2915-2923. Pubmed: 9603882
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837