Identification
Name:Acylphosphatase
Synonyms:
  • Acylphosphate phosphohydrolase
Gene Name:yccX
Enzyme Class:
Biological Properties
General Function:Involved in acylphosphatase activity
Specific Function:An acylphosphate + H(2)O = a carboxylate + phosphate
Cellular Location:Cytoplasmic
SMPDB Pathways:
KEGG Pathways:
  • 1,4-Dichlorobenzene degradation ec00627
  • Benzoate degradation via CoA ligation ec00632
  • Microbial metabolism in diverse environments ec01120
  • Pyruvate metabolism ec00620
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbBenzoic acid+Thumb
EcoCyc Reactions:
Thumb+an acyl phosphateThumb+a carboxylate+Thumb
Water + an acyl phosphate → Phosphate + a carboxylate + Hydrogen ion
ReactionCard
Complex Reactions:
Thumb+Thumb2 Thumb+Thumb+Thumb
Thumb+Thumb2 Thumb+Thumb+Thumb
Thumb+Thumb2 Thumb+Thumb+Thumb
Thumb+Thumb2 Thumb+Thumb+Thumb
Thumb+ThumbThumb+2 Thumb+Thumb
An acylphosphate+Thumba carboxylate+Thumb
An acylphosphate + Water → a carboxylate + Inorganic phosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB216453-Phospho-D-glycerateMetaboCard
ECMDB231413-phospho-D-glyceroyl phosphateMetaboCard
ECMDB00042Acetic acidMetaboCard
ECMDB01494AcetylphosphateMetaboCard
ECMDB20121Benzoyl phosphateMetaboCard
ECMDB21209Dodecanoate (N-C12:0)MetaboCard
ECMDB21210Dodecanoly-phosphate (n-C12:0)MetaboCard
ECMDB01270Glyceric acid 1,3-biphosphateMetaboCard
ECMDB21226Hexadecanoyl-phosphate (n-C16:0)MetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB21347Octadecanoate (N-C18:0)MetaboCard
ECMDB21258Octadecanoyl-phosphate (n-C18:0)MetaboCard
ECMDB21259Octadecanoyl-phosphate (n-C18:1)MetaboCard
ECMDB21348Octadecenoate (N-C18:1)MetaboCard
ECMDB00220Palmitic acidMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB21361tetradecanoate (n-C14:0)MetaboCard
ECMDB21286Tetradecanoyl-phosphate (n-C14:0)MetaboCard
ECMDB21362Tetradecenoate (N-C14:1)MetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
acylphosphatase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Gene Properties
Blattner:b0968
Gene OrientationClockwise
Centisome Percentage:22.18
Left Sequence End1029287
Right Sequence End1029565
Gene Sequence:
>279 bp
ATGAATCGGCCAGCAATATTAAAAAAGAAAGCAGCCAAAGATGTTGCTTCAGTATTAAAA
ATAATATTTTTATTTTATTTGTTCCTCATAGCTAGATTAAAACAACGTTATTCGATACGT
GAAATTAAGAGGGATTTATGGAACATCAGAGAAAACTATTCCAGCAACGCGGCTATAGCG
AAGATCTATTGCCGAAAACGCAAAGCCAGCGGACCTGGAAAACATTTAACTATTTTACCT
TATGGATGGGTTCGGTTCATAACGTTCCCAATTATGTGA
Protein Properties
Pfam Domain Function:
Protein Residues:92
Protein Molecular Weight:10300
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Acylphosphatase
MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQ
WLKSGGPRSARVERVLSEPHHPSGELTDFRIR
References
External Links:
ResourceLink
Uniprot ID:P0AB65
Uniprot Name:ACYP_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674648
Ecogene ID:EG13726
Ecocyc:EG13726
ColiBase:b0968
Kegg Gene:b0968
EchoBASE ID:EB3490
CCDB:ACYP_ECOLI
BacMap:16128935
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232
  • Pagano, K., Ramazzotti, M., Viglino, P., Esposito, G., Degl'Innocenti, D., Taddei, N., Corazza, A. (2006). "NMR solution structure of the acylphosphatase from Escherichia coli." J Biomol NMR 36:199-204. Pubmed: 17021943
  • Ramazzotti, M., Parrini, C., Stefani, M., Manao, G., Degl'Innocenti, D. (2006). "The intrachain disulfide bridge is responsible of the unusual stability properties of novel acylphosphatase from Escherichia coli." FEBS Lett 580:6763-6768. Pubmed: 17134700