Identification
Name:Zinc import ATP-binding protein ZnuC
Synonyms:Not Available
Gene Name:znuC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in nucleotide binding
Specific Function:Part of the ABC transporter complex ZnuABC involved in zinc import. Responsible for energy coupling to the transport system
Cellular Location:Cell inner membrane; Peripheral membrane protein
SMPDB Pathways:
  • Collection of Reactions without pathways PW001891
KEGG Pathways:
Transports:
Transport References:Not Available
EcoCyc Reactions:
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb+1.0Thumb+1.0Thumb
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00494WaterMetaboCard
ECMDB01303ZincMetaboCard
GO Classification:
Component
cell part
membrane
plasma membrane
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ATPase activity
binding
catalytic activity
cation transmembrane transporter activity
di-, tri-valent inorganic cation transmembrane transporter activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
inorganic cation transmembrane transporter activity
ion transmembrane transporter activity
nucleoside binding
nucleoside-triphosphatase activity
nucleotide binding
purine nucleoside binding
pyrophosphatase activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
zinc ion transmembrane transporter activity
zinc transporting ATPase activity
Process
cation transport
establishment of localization
ion transport
metal ion transport
transition metal ion transport
transport
zinc ion transport
Gene Properties
Blattner:b1858
Gene OrientationClockwise
Centisome Percentage:41.83
Left Sequence End1940686
Right Sequence End1941441
Gene Sequence:
>756 bp
ATGGCAACGGTTAATAAACAAGCCATTGCAGCGGCATTTGGTCGGGCAGCCGCACACTAT
GAGCAACATGCAGATCTACAGCGCCAGAGTGCTGACGCCTTACTGGCAATGCTTCCACAG
CGTAAATACACCCACGTACTGGACGCGGGTTGTGGACCTGGCTGGATGAGCCGCCACTGG
CGGGAACGTCACGCGCAGGTGACGGCCTTAGATCTCTCGCCGCCAATGCTTGTTCAGGCA
CGCCAGAAGGATGCCGCAGACCATTATCTGGCGGGAGATATCGAATCCCTGCCGTTAGCG
ACTGCGACGTTCGATCTTGCATGGAGCAATCTCGCAGTGCAGTGGTGCGGTAATTTATCC
ACGGCACTCCGCGAGCTGTATCGGGTGGTGCGCCCCAAAGGCGTGGTCGCGTTTACCACG
CTGGTGCAGGGATCGTTACCCGAACTGCATCAGGCGTGGCAGGCGGTGGACGAGCGTCCG
CATGCTAATCGCTTTTTACCGCCAGATGAAATCGAACAGTCGCTGAACGGCGTGCATTAT
CAACATCATATTCAGCCCATCACGCTGTGGTTTGATGATGCGCTCAGTGCCATGCGTTCG
CTGAAAGGCATCGGTGCCACGCATCTTCATGAAGGGCGCGACCCGCGAATATTAACGCGT
TCGCAGTTGCAGCGATTGCAACTGGCCTGGCCGCAACAGCAGGGGCGATATCCTCTGACG
TATCATCTTTTTTTGGGAGTGATTGCTCGTGAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:251
Protein Molecular Weight:27867
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Zinc import ATP-binding protein ZnuC
MTSLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLGLVTPDEGV
IKRNGKLRIGYVPQKLYLDTTLPLTVNRFLRLRPGTHKEDILPALKRVQAGHLINAPMQK
LSGGETQRVLLARALLNRPQLLVLDEPTQGVDVNGQVALYDLIDQLRRELDCGVLMVSHD
LHLVMAKTDEVLCLNHHICCSGTPEVVSLHPEFISMFGPRGAEQLGIYRHHHNHRHDLQG
RIVLRRGNDRS
References
External Links:
ResourceLink
Uniprot ID:P0A9X1
Uniprot Name:ZNUC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674760
Ecogene ID:EG13132
Ecocyc:EG13132
ColiBase:b1858
Kegg Gene:b1858
EchoBASE ID:EB2931
CCDB:ZNUC_ECOLI
BacMap:16129811
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Itoh, T., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Kasai, H., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Seki, Y., Horiuchi, T., et, a. l. .. (1996). "A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map." DNA Res 3:379-392. Pubmed: 9097040
  • Patzer, S. I., Hantke, K. (1998). "The ZnuABC high-affinity zinc uptake system and its regulator Zur in Escherichia coli." Mol Microbiol 28:1199-1210. Pubmed: 9680209
  • Yamamoto, K., Ishihama, A. (2005). "Transcriptional response of Escherichia coli to external zinc." J Bacteriol 187:6333-6340. Pubmed: 16159766